BLASTX nr result
ID: Glycyrrhiza28_contig00033949
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00033949 (568 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004509496.1 PREDICTED: pentatricopeptide repeat-containing pr... 124 7e-30 GAU43008.1 hypothetical protein TSUD_187290 [Trifolium subterran... 111 2e-25 XP_017408091.1 PREDICTED: pentatricopeptide repeat-containing pr... 106 2e-23 KOM32045.1 hypothetical protein LR48_Vigan01g160100 [Vigna angul... 106 2e-23 XP_017408083.1 PREDICTED: pentatricopeptide repeat-containing pr... 106 2e-23 XP_007156337.1 hypothetical protein PHAVU_003G278000g [Phaseolus... 103 2e-22 XP_014509843.1 PREDICTED: pentatricopeptide repeat-containing pr... 102 4e-22 XP_003629008.2 PPR containing plant-like protein [Medicago trunc... 99 1e-20 KRH07756.1 hypothetical protein GLYMA_16G108300 [Glycine max] 98 1e-20 KHN23777.1 Pentatricopeptide repeat-containing protein, mitochon... 98 1e-20 XP_003548696.2 PREDICTED: pentatricopeptide repeat-containing pr... 98 1e-20 XP_019446940.1 PREDICTED: pentatricopeptide repeat-containing pr... 94 6e-19 XP_018821443.1 PREDICTED: pentatricopeptide repeat-containing pr... 91 5e-18 XP_015950592.1 PREDICTED: pentatricopeptide repeat-containing pr... 86 4e-16 XP_016181796.1 PREDICTED: pentatricopeptide repeat-containing pr... 85 7e-16 XP_016679752.1 PREDICTED: pentatricopeptide repeat-containing pr... 82 6e-15 XP_012460040.1 PREDICTED: pentatricopeptide repeat-containing pr... 82 6e-15 XP_007040884.2 PREDICTED: pentatricopeptide repeat-containing pr... 80 2e-14 EOY25385.1 Tetratricopeptide repeat-like superfamily protein iso... 79 6e-14 XP_017641938.1 PREDICTED: pentatricopeptide repeat-containing pr... 79 8e-14 >XP_004509496.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Cicer arietinum] Length = 499 Score = 124 bits (310), Expect = 7e-30 Identities = 63/92 (68%), Positives = 69/92 (75%), Gaps = 4/92 (4%) Frame = -3 Query: 266 METVSENPRR----RISGLSKNPNKQPTPIPIPKPRHQAKNEFPSHLDAPNVSPTARTLC 99 ME V++NPR + SKNPNK TPIP KP H N+FPSHLD PNVS TARTLC Sbjct: 1 MEPVTKNPRTTQGIKFPSKSKNPNKNSTPIP--KPNHHQSNQFPSHLDTPNVSSTARTLC 58 Query: 98 NLLTRTSPHDIETALSSSGIHPLEECVQEVLR 3 NLLTRTSP DI+TALSSSGIHP EECV EVL+ Sbjct: 59 NLLTRTSPQDIDTALSSSGIHPSEECVHEVLK 90 >GAU43008.1 hypothetical protein TSUD_187290 [Trifolium subterraneum] Length = 502 Score = 111 bits (278), Expect = 2e-25 Identities = 58/92 (63%), Positives = 66/92 (71%), Gaps = 4/92 (4%) Frame = -3 Query: 266 METVSENPR----RRISGLSKNPNKQPTPIPIPKPRHQAKNEFPSHLDAPNVSPTARTLC 99 ME VS+NPR + SKNPN+ +PI P H N+FPSHLD PNVS TARTLC Sbjct: 1 MEAVSKNPRPTKIAKYPSKSKNPNRNSSPIRKPN-NHNQSNQFPSHLDTPNVSSTARTLC 59 Query: 98 NLLTRTSPHDIETALSSSGIHPLEECVQEVLR 3 NLLTRTSP DI++ALSSS IHP EECV EVL+ Sbjct: 60 NLLTRTSPQDIDSALSSSKIHPSEECVHEVLK 91 >XP_017408091.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X2 [Vigna angularis] Length = 484 Score = 106 bits (264), Expect = 2e-23 Identities = 60/91 (65%), Positives = 69/91 (75%), Gaps = 3/91 (3%) Frame = -3 Query: 266 METVSENPRRRISGL---SKNPNKQPTPIPIPKPRHQAKNEFPSHLDAPNVSPTARTLCN 96 ME V+ENP R +GL S NPNK P P PIPKP N+FPSHLDAPNVS +AR LC+ Sbjct: 5 MEAVAENPARS-TGLKYASINPNK-PQPSPIPKP-----NQFPSHLDAPNVSSSARALCD 57 Query: 95 LLTRTSPHDIETALSSSGIHPLEECVQEVLR 3 +LTR SPHDIETALSSSGI P E+ V+EVL+ Sbjct: 58 ILTRASPHDIETALSSSGIDPEEDLVKEVLK 88 >KOM32045.1 hypothetical protein LR48_Vigan01g160100 [Vigna angularis] Length = 497 Score = 106 bits (264), Expect = 2e-23 Identities = 60/91 (65%), Positives = 69/91 (75%), Gaps = 3/91 (3%) Frame = -3 Query: 266 METVSENPRRRISGL---SKNPNKQPTPIPIPKPRHQAKNEFPSHLDAPNVSPTARTLCN 96 ME V+ENP R +GL S NPNK P P PIPKP N+FPSHLDAPNVS +AR LC+ Sbjct: 5 MEAVAENPARS-TGLKYASINPNK-PQPSPIPKP-----NQFPSHLDAPNVSSSARALCD 57 Query: 95 LLTRTSPHDIETALSSSGIHPLEECVQEVLR 3 +LTR SPHDIETALSSSGI P E+ V+EVL+ Sbjct: 58 ILTRASPHDIETALSSSGIDPEEDLVKEVLK 88 >XP_017408083.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X1 [Vigna angularis] BAT75209.1 hypothetical protein VIGAN_01303700 [Vigna angularis var. angularis] Length = 534 Score = 106 bits (264), Expect = 2e-23 Identities = 60/91 (65%), Positives = 69/91 (75%), Gaps = 3/91 (3%) Frame = -3 Query: 266 METVSENPRRRISGL---SKNPNKQPTPIPIPKPRHQAKNEFPSHLDAPNVSPTARTLCN 96 ME V+ENP R +GL S NPNK P P PIPKP N+FPSHLDAPNVS +AR LC+ Sbjct: 5 MEAVAENPARS-TGLKYASINPNK-PQPSPIPKP-----NQFPSHLDAPNVSSSARALCD 57 Query: 95 LLTRTSPHDIETALSSSGIHPLEECVQEVLR 3 +LTR SPHDIETALSSSGI P E+ V+EVL+ Sbjct: 58 ILTRASPHDIETALSSSGIDPEEDLVKEVLK 88 >XP_007156337.1 hypothetical protein PHAVU_003G278000g [Phaseolus vulgaris] ESW28331.1 hypothetical protein PHAVU_003G278000g [Phaseolus vulgaris] Length = 514 Score = 103 bits (257), Expect = 2e-22 Identities = 56/90 (62%), Positives = 66/90 (73%), Gaps = 2/90 (2%) Frame = -3 Query: 266 METVSENPRRR--ISGLSKNPNKQPTPIPIPKPRHQAKNEFPSHLDAPNVSPTARTLCNL 93 ME V ENP R + S NPNK P P PIPKP N+FPSHLDAPNVS TAR +C++ Sbjct: 5 MEAVLENPARSRGLKYASINPNK-PQPPPIPKP-----NQFPSHLDAPNVSSTARAICDI 58 Query: 92 LTRTSPHDIETALSSSGIHPLEECVQEVLR 3 LTR SPHDIETALSSSGI P ++ ++EVL+ Sbjct: 59 LTRASPHDIETALSSSGIVPEDDLIEEVLK 88 >XP_014509843.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Vigna radiata var. radiata] Length = 497 Score = 102 bits (254), Expect = 4e-22 Identities = 57/90 (63%), Positives = 65/90 (72%), Gaps = 2/90 (2%) Frame = -3 Query: 266 METVSENPRRR--ISGLSKNPNKQPTPIPIPKPRHQAKNEFPSHLDAPNVSPTARTLCNL 93 ME V+ENP R S NPNK P PIPKP N+FPSHLDAPNVS +AR LC++ Sbjct: 5 MEAVAENPARSRGFKYASINPNK-PQQSPIPKP-----NQFPSHLDAPNVSSSARALCDI 58 Query: 92 LTRTSPHDIETALSSSGIHPLEECVQEVLR 3 LTR SPHDIETALSSSGI P E+ V+EVL+ Sbjct: 59 LTRASPHDIETALSSSGIDPEEDLVKEVLK 88 >XP_003629008.2 PPR containing plant-like protein [Medicago truncatula] AET03484.2 PPR containing plant-like protein [Medicago truncatula] Length = 506 Score = 98.6 bits (244), Expect = 1e-20 Identities = 52/74 (70%), Positives = 56/74 (75%) Frame = -3 Query: 224 LSKNPNKQPTPIPIPKPRHQAKNEFPSHLDAPNVSPTARTLCNLLTRTSPHDIETALSSS 45 + K NK+ P IPKP NEFPSHLD PNVS TARTLCNLLTRTSP DI+ ALSSS Sbjct: 23 IQKTLNKKFNP-KIPKP-----NEFPSHLDTPNVSSTARTLCNLLTRTSPQDIDNALSSS 76 Query: 44 GIHPLEECVQEVLR 3 GIHP EECV EVL+ Sbjct: 77 GIHPSEECVHEVLK 90 >KRH07756.1 hypothetical protein GLYMA_16G108300 [Glycine max] Length = 488 Score = 98.2 bits (243), Expect = 1e-20 Identities = 54/88 (61%), Positives = 63/88 (71%) Frame = -3 Query: 266 METVSENPRRRISGLSKNPNKQPTPIPIPKPRHQAKNEFPSHLDAPNVSPTARTLCNLLT 87 ME ++ENP R S K+P+K PT P P N+FPSHLDAPNVS TAR LC++LT Sbjct: 1 MEALAENPGR--SRDLKHPSKNPTKPPQP-------NQFPSHLDAPNVSSTARALCDILT 51 Query: 86 RTSPHDIETALSSSGIHPLEECVQEVLR 3 R+SP DIE+ALSSSGI P EEC EVLR Sbjct: 52 RSSPQDIESALSSSGIVPEEECTNEVLR 79 >KHN23777.1 Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 488 Score = 98.2 bits (243), Expect = 1e-20 Identities = 54/88 (61%), Positives = 63/88 (71%) Frame = -3 Query: 266 METVSENPRRRISGLSKNPNKQPTPIPIPKPRHQAKNEFPSHLDAPNVSPTARTLCNLLT 87 ME ++ENP R S K+P+K PT P P N+FPSHLDAPNVS TAR LC++LT Sbjct: 1 MEALAENPGR--SRDLKHPSKNPTKPPQP-------NQFPSHLDAPNVSSTARALCDILT 51 Query: 86 RTSPHDIETALSSSGIHPLEECVQEVLR 3 R+SP DIE+ALSSSGI P EEC EVLR Sbjct: 52 RSSPQDIESALSSSGIVPEEECTNEVLR 79 >XP_003548696.2 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Glycine max] Length = 492 Score = 98.2 bits (243), Expect = 1e-20 Identities = 54/88 (61%), Positives = 63/88 (71%) Frame = -3 Query: 266 METVSENPRRRISGLSKNPNKQPTPIPIPKPRHQAKNEFPSHLDAPNVSPTARTLCNLLT 87 ME ++ENP R S K+P+K PT P P N+FPSHLDAPNVS TAR LC++LT Sbjct: 5 MEALAENPGR--SRDLKHPSKNPTKPPQP-------NQFPSHLDAPNVSSTARALCDILT 55 Query: 86 RTSPHDIETALSSSGIHPLEECVQEVLR 3 R+SP DIE+ALSSSGI P EEC EVLR Sbjct: 56 RSSPQDIESALSSSGIVPEEECTNEVLR 83 >XP_019446940.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Lupinus angustifolius] OIW09595.1 hypothetical protein TanjilG_28194 [Lupinus angustifolius] Length = 482 Score = 93.6 bits (231), Expect = 6e-19 Identities = 52/88 (59%), Positives = 60/88 (68%) Frame = -3 Query: 266 METVSENPRRRISGLSKNPNKQPTPIPIPKPRHQAKNEFPSHLDAPNVSPTARTLCNLLT 87 M+TVSENP + KQPT IPKP NEFPSHL PNVSPTAR LC+LLT Sbjct: 1 MDTVSENPNK------PQKIKQPT---IPKP-----NEFPSHLTTPNVSPTARALCDLLT 46 Query: 86 RTSPHDIETALSSSGIHPLEECVQEVLR 3 RTSP +IETAL SS +HP +CV EV++ Sbjct: 47 RTSPLEIETALQSSNVHPSADCVIEVIK 74 >XP_018821443.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Juglans regia] Length = 491 Score = 90.9 bits (224), Expect = 5e-18 Identities = 47/88 (53%), Positives = 58/88 (65%) Frame = -3 Query: 266 METVSENPRRRISGLSKNPNKQPTPIPIPKPRHQAKNEFPSHLDAPNVSPTARTLCNLLT 87 ME ++ NP S LS+ P +P+ P HQ FPSHLDAP +S ART+C +LT Sbjct: 1 MEAMAVNPNTSSSSLSQIPTNSTSPLKPLLPIHQ----FPSHLDAPEISSAARTICEILT 56 Query: 86 RTSPHDIETALSSSGIHPLEECVQEVLR 3 R SPHDIE+ALSS+GI P E VQEVL+ Sbjct: 57 RVSPHDIESALSSTGISPSTEIVQEVLK 84 >XP_015950592.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Arachis duranensis] Length = 491 Score = 85.5 bits (210), Expect = 4e-16 Identities = 48/87 (55%), Positives = 57/87 (65%) Frame = -3 Query: 266 METVSENPRRRISGLSKNPNKQPTPIPIPKPRHQAKNEFPSHLDAPNVSPTARTLCNLLT 87 ME ++ NPRR S NKQ IPKP Q N+FPSH DA +VSP AR LC LLT Sbjct: 1 MEALASNPRR-----STASNKQQQEAKIPKP--QRPNQFPSHRDAVHVSPNARKLCELLT 53 Query: 86 RTSPHDIETALSSSGIHPLEECVQEVL 6 RT P+DIETAL++ GI P ++ V EVL Sbjct: 54 RTPPNDIETALTNCGIRPSQDEVHEVL 80 >XP_016181796.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Arachis ipaensis] Length = 491 Score = 84.7 bits (208), Expect = 7e-16 Identities = 48/87 (55%), Positives = 56/87 (64%) Frame = -3 Query: 266 METVSENPRRRISGLSKNPNKQPTPIPIPKPRHQAKNEFPSHLDAPNVSPTARTLCNLLT 87 ME ++ NPRR S NKQ IPKP Q N+FPSH DA +VSP AR LC LLT Sbjct: 1 MEALASNPRR-----STASNKQQQEAKIPKP--QRPNQFPSHRDAVHVSPNARKLCELLT 53 Query: 86 RTSPHDIETALSSSGIHPLEECVQEVL 6 RT P+DIETAL++ GI P + V EVL Sbjct: 54 RTPPNDIETALTNCGIRPSHDEVHEVL 80 >XP_016679752.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X1 [Gossypium hirsutum] XP_016679753.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X2 [Gossypium hirsutum] Length = 490 Score = 82.0 bits (201), Expect = 6e-15 Identities = 42/87 (48%), Positives = 57/87 (65%) Frame = -3 Query: 266 METVSENPRRRISGLSKNPNKQPTPIPIPKPRHQAKNEFPSHLDAPNVSPTARTLCNLLT 87 MET++EN + L + P QP IP + FP+H DAP++SPT R LC+LLT Sbjct: 1 METIAENHSTK---LPRKPQNQPRSIP----NNLQPQSFPTHHDAPDISPTVRILCDLLT 53 Query: 86 RTSPHDIETALSSSGIHPLEECVQEVL 6 R SPHDIE+ALSS+G+ P + +Q+VL Sbjct: 54 RISPHDIESALSSTGVIPTSDDIQQVL 80 >XP_012460040.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Gossypium raimondii] XP_012460041.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Gossypium raimondii] KJB78239.1 hypothetical protein B456_012G184800 [Gossypium raimondii] Length = 490 Score = 82.0 bits (201), Expect = 6e-15 Identities = 42/87 (48%), Positives = 57/87 (65%) Frame = -3 Query: 266 METVSENPRRRISGLSKNPNKQPTPIPIPKPRHQAKNEFPSHLDAPNVSPTARTLCNLLT 87 MET++EN + L + P QP IP + FP+H DAP++SPT R LC+LLT Sbjct: 1 METIAENHSTK---LPRKPQNQPRSIP----NNLQPQRFPTHHDAPDISPTVRILCDLLT 53 Query: 86 RTSPHDIETALSSSGIHPLEECVQEVL 6 R SPHDIE+ALSS+G+ P + +Q+VL Sbjct: 54 RISPHDIESALSSTGVIPTSDDIQQVL 80 >XP_007040884.2 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial [Theobroma cacao] Length = 491 Score = 80.5 bits (197), Expect = 2e-14 Identities = 44/87 (50%), Positives = 55/87 (63%) Frame = -3 Query: 266 METVSENPRRRISGLSKNPNKQPTPIPIPKPRHQAKNEFPSHLDAPNVSPTARTLCNLLT 87 ME V+EN + L P QP IP + F +HLDAP++SPTAR LC+LL+ Sbjct: 1 MEAVAEN---HSTTLPTKPQNQPPSNSIP--HNLQPQRFRTHLDAPDISPTARILCDLLS 55 Query: 86 RTSPHDIETALSSSGIHPLEECVQEVL 6 R SPHD+ETALS +GI P E +QEVL Sbjct: 56 RASPHDVETALSCTGITPTAEVIQEVL 82 >EOY25385.1 Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] EOY25386.1 Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] Length = 491 Score = 79.3 bits (194), Expect = 6e-14 Identities = 44/87 (50%), Positives = 55/87 (63%) Frame = -3 Query: 266 METVSENPRRRISGLSKNPNKQPTPIPIPKPRHQAKNEFPSHLDAPNVSPTARTLCNLLT 87 ME V+EN + L P QP IP + F +HLDAP++SPTAR LC+LL+ Sbjct: 1 MEAVAEN---HSTTLPTKPPNQPHSNSIP--HNLQPQRFRTHLDAPDISPTARILCDLLS 55 Query: 86 RTSPHDIETALSSSGIHPLEECVQEVL 6 R SPHD+ETALS +GI P E +QEVL Sbjct: 56 RASPHDVETALSCTGITPTAEVIQEVL 82 >XP_017641938.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Gossypium arboreum] XP_017641939.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Gossypium arboreum] KHG19501.1 hypothetical protein F383_01163 [Gossypium arboreum] Length = 490 Score = 79.0 bits (193), Expect = 8e-14 Identities = 42/87 (48%), Positives = 56/87 (64%) Frame = -3 Query: 266 METVSENPRRRISGLSKNPNKQPTPIPIPKPRHQAKNEFPSHLDAPNVSPTARTLCNLLT 87 MET++EN + L + P Q IP + FP+H DAP++SPT R LC+LLT Sbjct: 1 METIAENHSTK---LPRKPENQLRSIP----NNLQPQRFPTHHDAPDISPTVRILCDLLT 53 Query: 86 RTSPHDIETALSSSGIHPLEECVQEVL 6 R SPHDIE+ALSS+GI P + +Q+VL Sbjct: 54 RVSPHDIESALSSTGIIPTSDDIQQVL 80