BLASTX nr result
ID: Glycyrrhiza28_contig00033900
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00033900 (242 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_014628528.1 PREDICTED: pentatricopeptide repeat-containing pr... 96 2e-21 XP_007144015.1 hypothetical protein PHAVU_007G122000g [Phaseolus... 86 1e-17 XP_019426945.1 PREDICTED: pentatricopeptide repeat-containing pr... 76 2e-14 XP_014513289.1 PREDICTED: pentatricopeptide repeat-containing pr... 72 4e-13 XP_019453263.1 PREDICTED: pentatricopeptide repeat-containing pr... 72 8e-13 XP_017410977.1 PREDICTED: pentatricopeptide repeat-containing pr... 71 1e-12 XP_004495572.1 PREDICTED: pentatricopeptide repeat-containing pr... 70 3e-12 XP_015940302.1 PREDICTED: pentatricopeptide repeat-containing pr... 68 1e-11 XP_016175839.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 2e-10 XP_003590961.1 PPR containing plant-like protein [Medicago trunc... 59 2e-08 GAV82988.1 PPR domain-containing protein/PPR_1 domain-containing... 54 1e-06 OAY43241.1 hypothetical protein MANES_08G053700 [Manihot esculen... 52 7e-06 >XP_014628528.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08610-like [Glycine max] KRG92629.1 hypothetical protein GLYMA_20G222900 [Glycine max] KRG92630.1 hypothetical protein GLYMA_20G222900 [Glycine max] Length = 589 Score = 95.9 bits (237), Expect = 2e-21 Identities = 50/83 (60%), Positives = 61/83 (73%), Gaps = 4/83 (4%) Frame = +2 Query: 5 DHSSRKNYPLSWRGLQCRSLRASVLIDRVGEVDHEEG-FKSYYVGERRKSRELVDSNKSL 181 D+ S Y + W+GL+CRS + SVLIDR EVDHE+ F S YVGERR SREL+DS KS+ Sbjct: 55 DYFSTTKYSIPWKGLRCRSFQRSVLIDRANEVDHEDWCFGSDYVGERRNSRELLDSKKSV 114 Query: 182 HSP---PEGHFVKNSEVTNNEIL 241 +SP PE FV+N E+TNNEIL Sbjct: 115 NSPTLSPEAPFVQNDEMTNNEIL 137 >XP_007144015.1 hypothetical protein PHAVU_007G122000g [Phaseolus vulgaris] ESW16009.1 hypothetical protein PHAVU_007G122000g [Phaseolus vulgaris] Length = 589 Score = 85.5 bits (210), Expect = 1e-17 Identities = 46/83 (55%), Positives = 56/83 (67%), Gaps = 4/83 (4%) Frame = +2 Query: 5 DHSSRKNYPLSWRGLQCRSLRASVLIDRVGEVDHE-EGFKSYYVGERRKSRELVDSNKSL 181 D+ Y W+GL+CRS + SVLIDRV E DHE G +S +VG RR SREL+DSN S Sbjct: 55 DYFCSTKYSFPWKGLRCRSFQGSVLIDRVIEADHEGRGSESDFVGVRRNSRELMDSNNSR 114 Query: 182 HSP---PEGHFVKNSEVTNNEIL 241 +SP PE FV+N E TNN+IL Sbjct: 115 NSPSLSPEAPFVENDETTNNKIL 137 >XP_019426945.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08610-like [Lupinus angustifolius] Length = 589 Score = 76.3 bits (186), Expect = 2e-14 Identities = 48/85 (56%), Positives = 54/85 (63%), Gaps = 6/85 (7%) Frame = +2 Query: 5 DHSSRKNYPLSWRGLQCRSLRASVLIDRVGEVDHEE-GFKSYYVG--ERRKSRELVDSNK 175 D+ Y + RGLQCRS R SVLIDRV EV E+ F SY VG +RRK E VDSNK Sbjct: 52 DYFPPSEYCVPRRGLQCRSSRGSVLIDRVNEVKCEDFSFGSYSVGDHDRRKLTESVDSNK 111 Query: 176 SLHSP---PEGHFVKNSEVTNNEIL 241 ++SP PEG FV N E TNN IL Sbjct: 112 DVYSPALLPEGAFVHNDERTNNNIL 136 >XP_014513289.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08610 [Vigna radiata var. radiata] XP_014513290.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08610 [Vigna radiata var. radiata] Length = 590 Score = 72.4 bits (176), Expect = 4e-13 Identities = 46/101 (45%), Positives = 56/101 (55%), Gaps = 22/101 (21%) Frame = +2 Query: 5 DHSSRKNYPLS-----------------WRGLQCRSLRASVLIDRVGEVDH-EEGFKSYY 130 DHSSRK P+ W+GL+C+S SVLIDRV EVD+ G S Y Sbjct: 38 DHSSRKESPIRHRVYFGDYFCSTKYHFPWKGLRCKSFHGSVLIDRVVEVDNGGRGSGSDY 97 Query: 131 VGERRKSRELVDSNKSLH----SPPEGHFVKNSEVTNNEIL 241 VG R SR+L DSN + + SP E FV+N E TNN+IL Sbjct: 98 VGVMRNSRDLKDSNNARNSPSLSPEEAPFVENDETTNNKIL 138 >XP_019453263.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08610-like [Lupinus angustifolius] XP_019453264.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08610-like [Lupinus angustifolius] OIW07167.1 hypothetical protein TanjilG_10140 [Lupinus angustifolius] Length = 591 Score = 71.6 bits (174), Expect = 8e-13 Identities = 46/85 (54%), Positives = 53/85 (62%), Gaps = 6/85 (7%) Frame = +2 Query: 5 DHSSRKNYPLSWRGLQCRSLRASVLIDRVGEVDHEE-GFKSYYVGERRKSR--ELVDSNK 175 D+ Y + RGLQCRS R SVLIDRV EV HE +S VG +KS+ E VDSNK Sbjct: 52 DYLPLTKYCVRRRGLQCRSSRGSVLIDRVDEVKHESFPLESSDVGGHKKSKFTESVDSNK 111 Query: 176 SLHSP---PEGHFVKNSEVTNNEIL 241 ++SP PEG FV N E TNN IL Sbjct: 112 YVYSPATLPEGAFVHNDEKTNNNIL 136 >XP_017410977.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08610 [Vigna angularis] XP_017410979.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08610 [Vigna angularis] KOM29997.1 hypothetical protein LR48_Vigan845s002500 [Vigna angularis] BAT94932.1 hypothetical protein VIGAN_08158400 [Vigna angularis var. angularis] Length = 590 Score = 71.2 bits (173), Expect = 1e-12 Identities = 46/101 (45%), Positives = 55/101 (54%), Gaps = 22/101 (21%) Frame = +2 Query: 5 DHSSRKN-----------------YPLSWRGLQCRSLRASVLIDRVGEVDH-EEGFKSYY 130 DHSSRK Y W+GL+C+S SVLIDRV EV++ GF S Y Sbjct: 38 DHSSRKEPPTLHRLYFGDYFCSTKYHFPWKGLRCKSFHGSVLIDRVVEVENGGRGFGSDY 97 Query: 131 VGERRKSRELVDS----NKSLHSPPEGHFVKNSEVTNNEIL 241 VG RR S +L DS N + SP E FV+N E TNN+IL Sbjct: 98 VGVRRNSGDLKDSDNARNSTSLSPEEAPFVENDETTNNKIL 138 >XP_004495572.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08610 [Cicer arietinum] XP_004495573.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08610 [Cicer arietinum] Length = 578 Score = 70.1 bits (170), Expect = 3e-12 Identities = 47/98 (47%), Positives = 62/98 (63%), Gaps = 18/98 (18%) Frame = +2 Query: 2 SDHSSRK-------------NYPLSWRGLQCRSLRASVLIDRVG-EVDHEE-GFKSYYVG 136 S+HSSRK N W+GL+CRSL A++L DRV EVDHE+ GF+SY Sbjct: 35 SNHSSRKIMSSLHQNDCFSTNRCSYWKGLRCRSLYATLLNDRVDYEVDHEDWGFESY--- 91 Query: 137 ERRKSRELVDSNKSLHSP---PEGHFVKNSEVTNNEIL 241 K E +DS KS++SP P+G FV+N+E+TNN+IL Sbjct: 92 -AGKGGEQMDSVKSINSPTLSPDGPFVRNNEITNNKIL 128 >XP_015940302.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08610 [Arachis duranensis] Length = 593 Score = 68.2 bits (165), Expect = 1e-11 Identities = 42/75 (56%), Positives = 50/75 (66%), Gaps = 8/75 (10%) Frame = +2 Query: 41 RGLQCRSL--RASVLIDRVGEVDHEE-GFKSYYVGERRKSR--ELVDSNKSLHSP---PE 196 +GL CRS R SVL+DRV EVDHE+ F+ Y VGE + ELVD NKS+ SP P+ Sbjct: 67 KGLPCRSFQERGSVLLDRVNEVDHEDWAFEGYSVGEGNNNEFTELVDLNKSIDSPSLSPD 126 Query: 197 GHFVKNSEVTNNEIL 241 G FV N+E TNN IL Sbjct: 127 GPFVGNNEKTNNMIL 141 >XP_016175839.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08610 [Arachis ipaensis] Length = 593 Score = 65.1 bits (157), Expect = 2e-10 Identities = 41/75 (54%), Positives = 49/75 (65%), Gaps = 8/75 (10%) Frame = +2 Query: 41 RGLQCRSL--RASVLIDRVGEVDHEE-GFKSYYVGERRKSR--ELVDSNKSLHSP---PE 196 +GL CRS R SVL+DRV EVDHE+ F+ Y VGE S LVD NKS+ SP P+ Sbjct: 67 KGLPCRSFQRRGSVLLDRVNEVDHEDWAFEGYSVGEGSNSEFTGLVDLNKSIDSPSSSPD 126 Query: 197 GHFVKNSEVTNNEIL 241 G FV N++ TNN IL Sbjct: 127 GPFVGNNQKTNNMIL 141 >XP_003590961.1 PPR containing plant-like protein [Medicago truncatula] AES61212.1 PPR containing plant-like protein [Medicago truncatula] Length = 573 Score = 58.9 bits (141), Expect = 2e-08 Identities = 38/73 (52%), Positives = 50/73 (68%), Gaps = 4/73 (5%) Frame = +2 Query: 35 SWRGLQCRSLRASVLIDRVGEVDHEE-GFKSYYVGERRKSRELVDSNKSLHS---PPEGH 202 SW+GL+CR+ VL DRV EVDHE+ GF+S G+R +S ELV SL+S EG Sbjct: 50 SWKGLRCRT----VLSDRVDEVDHEDWGFES-NTGKRVESSELVHLVTSLNSSTLSAEGQ 104 Query: 203 FVKNSEVTNNEIL 241 FV+N E+T+N+IL Sbjct: 105 FVRNGELTSNKIL 117 >GAV82988.1 PPR domain-containing protein/PPR_1 domain-containing protein/PPR_2 domain-containing protein [Cephalotus follicularis] Length = 595 Score = 53.9 bits (128), Expect = 1e-06 Identities = 37/84 (44%), Positives = 45/84 (53%), Gaps = 14/84 (16%) Frame = +2 Query: 32 LSWRG----------LQCRSLRASVLIDRVGEVDHEEGFKSYYV-GERRKSRELVDSNKS 178 L WRG LQCR L+ S + D V E D +E V G + KSRE + KS Sbjct: 60 LQWRGALGSGKNVFSLQCRGLQRSAISDTVDESDEDEWSSEIGVLGVKAKSREQIALKKS 119 Query: 179 LHS---PPEGHFVKNSEVTNNEIL 241 +S P +G FVK +EVTNNEIL Sbjct: 120 PNSLMVPVDGPFVKKNEVTNNEIL 143 >OAY43241.1 hypothetical protein MANES_08G053700 [Manihot esculenta] OAY43242.1 hypothetical protein MANES_08G053700 [Manihot esculenta] OAY43243.1 hypothetical protein MANES_08G053700 [Manihot esculenta] OAY43244.1 hypothetical protein MANES_08G053700 [Manihot esculenta] Length = 590 Score = 52.0 bits (123), Expect = 7e-06 Identities = 34/69 (49%), Positives = 44/69 (63%), Gaps = 4/69 (5%) Frame = +2 Query: 47 LQCRSLRASVLIDRVGEVDHEE-GFKSYYVGERRKSRELVDSNKSLHSPP---EGHFVKN 214 LQC+ L+ SV IDRV E D +E +++ G RKSRE + S K+ SP +G FV+N Sbjct: 71 LQCKGLQRSVCIDRVDENDQDEWNSETHLSGVGRKSREQI-STKNHGSPALSIDGPFVEN 129 Query: 215 SEVTNNEIL 241 E TNNEIL Sbjct: 130 DEETNNEIL 138