BLASTX nr result
ID: Glycyrrhiza28_contig00033796
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00033796 (325 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KUM45867.1 hypothetical protein ABT39_MTgene2221 (mitochondrion)... 44 5e-09 >KUM45867.1 hypothetical protein ABT39_MTgene2221 (mitochondrion) [Picea glauca] Length = 77 Score = 44.3 bits (103), Expect(3) = 5e-09 Identities = 22/32 (68%), Positives = 25/32 (78%), Gaps = 2/32 (6%) Frame = +2 Query: 80 MLETDP*DWNRLASIYSVYSCEEKP--PFPAF 169 ML TDP D NRLAS++S+ SCEEKP PFP F Sbjct: 1 MLSTDPEDLNRLASVHSLSSCEEKPSYPFPWF 32 Score = 42.4 bits (98), Expect(3) = 5e-09 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 186 IGLMIPLSLFPRPVPGVYPD 245 IGLMIP LFPRPVPGVYPD Sbjct: 40 IGLMIPFYLFPRPVPGVYPD 59 Score = 20.8 bits (42), Expect(3) = 5e-09 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 154 PFPCFLDLYD 183 PFP FLDL D Sbjct: 28 PFPWFLDLCD 37