BLASTX nr result
ID: Glycyrrhiza28_contig00033624
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00033624 (507 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012567370.1 PREDICTED: putative FBD-associated F-box protein ... 66 2e-19 XP_003622672.1 FBD-associated F-box plant protein [Medicago trun... 63 5e-18 XP_019425214.1 PREDICTED: putative FBD-associated F-box protein ... 57 1e-11 OIV91636.1 hypothetical protein TanjilG_09048 [Lupinus angustifo... 57 1e-11 XP_003623896.1 FBD-associated F-box plant protein, putative [Med... 69 1e-10 XP_015888041.1 PREDICTED: putative FBD-associated F-box protein ... 45 2e-09 XP_002305656.2 hypothetical protein POPTR_0004s03450g [Populus t... 52 4e-09 XP_007148243.1 hypothetical protein PHAVU_006G192000g [Phaseolus... 61 8e-08 XP_013457041.1 FBD-associated F-box plant protein [Medicago trun... 59 5e-07 XP_014518059.1 PREDICTED: putative FBD-associated F-box protein ... 58 1e-06 XP_017435324.1 PREDICTED: putative FBD-associated F-box protein ... 55 6e-06 XP_017435323.1 PREDICTED: putative FBD-associated F-box protein ... 55 6e-06 XP_002316659.2 hypothetical protein POPTR_0011s04270g [Populus t... 55 6e-06 KYP63000.1 Putative FBD-associated F-box protein At1g61330 famil... 55 8e-06 >XP_012567370.1 PREDICTED: putative FBD-associated F-box protein At1g61330 [Cicer arietinum] Length = 469 Score = 65.9 bits (159), Expect(2) = 2e-19 Identities = 32/51 (62%), Positives = 37/51 (72%) Frame = -3 Query: 154 IQVLVASVCNGQFREAQCRLGNLIELQLFMEGGMFCNPYDIAVFIKNCPSL 2 I+ L A +G FREA+ L ELQLFMEGGMFCNPYDI +F+K CPSL Sbjct: 288 IEALSARFRDGIFREAEYNFFYLRELQLFMEGGMFCNPYDIYLFLKRCPSL 338 Score = 57.0 bits (136), Expect(2) = 2e-19 Identities = 34/70 (48%), Positives = 41/70 (58%) Frame = -2 Query: 467 IRSPMLCSMFYCGVIPNRIVFAPGVALLEACFNFTPTRNYIQASQVESLDNHFHSVRVLT 288 I S L S FY G +P RI F + L EA F P+RNYIQ +Q+E+L N F V VLT Sbjct: 224 IDSSTLSSFFYHGKLP-RIQFVQAMRLYEAYFYIIPSRNYIQPAQLEALANDFSKVAVLT 282 Query: 287 TSVKFLEVYS 258 TS +E S Sbjct: 283 TSSILIEALS 292 >XP_003622672.1 FBD-associated F-box plant protein [Medicago truncatula] AES78890.1 FBD-associated F-box plant protein [Medicago truncatula] Length = 474 Score = 63.2 bits (152), Expect(2) = 5e-18 Identities = 29/51 (56%), Positives = 36/51 (70%) Frame = -3 Query: 154 IQVLVASVCNGQFREAQCRLGNLIELQLFMEGGMFCNPYDIAVFIKNCPSL 2 I+ + + +G REAQ NL ELQLFM+G FCNPYDI +F+KNCPSL Sbjct: 297 IEGMAVRIRDGVLREAQYCFVNLRELQLFMDGAKFCNPYDITMFLKNCPSL 347 Score = 55.1 bits (131), Expect(2) = 5e-18 Identities = 30/67 (44%), Positives = 43/67 (64%) Frame = -2 Query: 467 IRSPMLCSMFYCGVIPNRIVFAPGVALLEACFNFTPTRNYIQASQVESLDNHFHSVRVLT 288 I SP L S+FY G P I A G+ L +A F FTP+R Y+Q++Q+E+L F V +LT Sbjct: 233 IDSPTLSSIFYHGKFPI-IRIAQGMQLYDALFRFTPSREYMQSTQLEALAKDFLHVSILT 291 Query: 287 TSVKFLE 267 T+ + +E Sbjct: 292 TTPQLIE 298 >XP_019425214.1 PREDICTED: putative FBD-associated F-box protein At1g61330 [Lupinus angustifolius] Length = 486 Score = 56.6 bits (135), Expect(2) = 1e-11 Identities = 26/50 (52%), Positives = 33/50 (66%) Frame = -3 Query: 151 QVLVASVCNGQFREAQCRLGNLIELQLFMEGGMFCNPYDIAVFIKNCPSL 2 + L + +G F+E+Q NL EL L MEG MFCNPYDI +F+KN P L Sbjct: 314 EALASRYHDGVFKESQFCFSNLKELHLIMEGAMFCNPYDIIMFLKNSPCL 363 Score = 39.7 bits (91), Expect(2) = 1e-11 Identities = 29/68 (42%), Positives = 37/68 (54%), Gaps = 1/68 (1%) Frame = -2 Query: 467 IRSPMLCSMFYCGVIPNRIVFAPGVALLE-ACFNFTPTRNYIQASQVESLDNHFHSVRVL 291 I +P L + Y G I N F V LL A F F +RNY + S +E++ H VRVL Sbjct: 248 IDAPTLQRIHYSGFIIN-FQFTQIVPLLNVANFTFYRSRNYWRPSTLENVAKHVLHVRVL 306 Query: 290 TTSVKFLE 267 TTS +F E Sbjct: 307 TTSAQFQE 314 >OIV91636.1 hypothetical protein TanjilG_09048 [Lupinus angustifolius] Length = 406 Score = 56.6 bits (135), Expect(2) = 1e-11 Identities = 26/50 (52%), Positives = 33/50 (66%) Frame = -3 Query: 151 QVLVASVCNGQFREAQCRLGNLIELQLFMEGGMFCNPYDIAVFIKNCPSL 2 + L + +G F+E+Q NL EL L MEG MFCNPYDI +F+KN P L Sbjct: 234 EALASRYHDGVFKESQFCFSNLKELHLIMEGAMFCNPYDIIMFLKNSPCL 283 Score = 39.7 bits (91), Expect(2) = 1e-11 Identities = 29/68 (42%), Positives = 37/68 (54%), Gaps = 1/68 (1%) Frame = -2 Query: 467 IRSPMLCSMFYCGVIPNRIVFAPGVALLE-ACFNFTPTRNYIQASQVESLDNHFHSVRVL 291 I +P L + Y G I N F V LL A F F +RNY + S +E++ H VRVL Sbjct: 168 IDAPTLQRIHYSGFIIN-FQFTQIVPLLNVANFTFYRSRNYWRPSTLENVAKHVLHVRVL 226 Query: 290 TTSVKFLE 267 TTS +F E Sbjct: 227 TTSAQFQE 234 >XP_003623896.1 FBD-associated F-box plant protein, putative [Medicago truncatula] AES80114.1 FBD-associated F-box plant protein, putative [Medicago truncatula] Length = 474 Score = 69.3 bits (168), Expect = 1e-10 Identities = 41/98 (41%), Positives = 56/98 (57%) Frame = -3 Query: 295 FSPLQ*NS*RYIHIQ**FLDIVYIFNIHLTPLFLFYLPSCQ*K*NLGIQVLVASVCNGQF 116 F P Q N ++ H++ D+ ++ + TPL I+ + A + NG + Sbjct: 267 FIPSQ-NYMKFDHLEALVKDLSHVSVLTTTPLL--------------IESVAARIRNGIY 311 Query: 115 REAQCRLGNLIELQLFMEGGMFCNPYDIAVFIKNCPSL 2 +EAQ NLIELQLFM+GGM CNPYDI +F KNCPSL Sbjct: 312 QEAQYWFENLIELQLFMKGGMSCNPYDITMFAKNCPSL 349 >XP_015888041.1 PREDICTED: putative FBD-associated F-box protein At1g61330 [Ziziphus jujuba] Length = 502 Score = 44.7 bits (104), Expect(2) = 2e-09 Identities = 25/67 (37%), Positives = 40/67 (59%) Frame = -2 Query: 467 IRSPMLCSMFYCGVIPNRIVFAPGVALLEACFNFTPTRNYIQASQVESLDNHFHSVRVLT 288 I SP L S++Y G + + V P L + NFTP++ +I++SQVE+L + + + T Sbjct: 264 IDSPTLQSLYYHGPVRDLKVANPS-QLKDVMLNFTPSKGFIRSSQVENLVSDISRITLFT 322 Query: 287 TSVKFLE 267 T+ FLE Sbjct: 323 TTSTFLE 329 Score = 44.7 bits (104), Expect(2) = 2e-09 Identities = 21/51 (41%), Positives = 28/51 (54%) Frame = -3 Query: 154 IQVLVASVCNGQFREAQCRLGNLIELQLFMEGGMFCNPYDIAVFIKNCPSL 2 ++ L + G FR+ NL E QLFMEG +CN DIA F+ CP + Sbjct: 328 LEGLTTRIREGVFRDLHYCFWNLKEFQLFMEGASYCNLCDIASFLAKCPRI 378 >XP_002305656.2 hypothetical protein POPTR_0004s03450g [Populus trichocarpa] EEE86167.2 hypothetical protein POPTR_0004s03450g [Populus trichocarpa] Length = 490 Score = 52.0 bits (123), Expect(2) = 4e-09 Identities = 24/51 (47%), Positives = 28/51 (54%) Frame = -3 Query: 154 IQVLVASVCNGQFREAQCRLGNLIELQLFMEGGMFCNPYDIAVFIKNCPSL 2 ++ L G E Q NLIE L MEG M+CNPYDI F+KNC L Sbjct: 316 LEGLTPKFMGGTLTEMQFSFWNLIEFHLIMEGAMYCNPYDIVSFLKNCQYL 366 Score = 36.2 bits (82), Expect(2) = 4e-09 Identities = 22/67 (32%), Positives = 36/67 (53%) Frame = -2 Query: 467 IRSPMLCSMFYCGVIPNRIVFAPGVALLEACFNFTPTRNYIQASQVESLDNHFHSVRVLT 288 I +P L ++ YCG + I F + + NF P++ + QV +L +++RVLT Sbjct: 252 IDAPTLHAIHYCGHVCF-IKFTNIPEVKDVMLNFGPSKGFTGTFQVRNLVYDLYNIRVLT 310 Query: 287 TSVKFLE 267 T+ FLE Sbjct: 311 TTSTFLE 317 >XP_007148243.1 hypothetical protein PHAVU_006G192000g [Phaseolus vulgaris] ESW20237.1 hypothetical protein PHAVU_006G192000g [Phaseolus vulgaris] Length = 483 Score = 60.8 bits (146), Expect = 8e-08 Identities = 28/46 (60%), Positives = 30/46 (65%) Frame = -3 Query: 145 LVASVCNGQFREAQCRLGNLIELQLFMEGGMFCNPYDIAVFIKNCP 8 L A V G F EA NLIEL L MEGG+FCNPYDI F+K CP Sbjct: 309 LTAKVRRGVFGEASYSFSNLIELHLIMEGGLFCNPYDILAFMKRCP 354 >XP_013457041.1 FBD-associated F-box plant protein [Medicago truncatula] KEH31072.1 FBD-associated F-box plant protein [Medicago truncatula] Length = 473 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = -3 Query: 124 GQFREAQCRLGNLIELQLFMEGGMFCNPYDIAVFIKNCPSL 2 G F+E Q N+ ELQLFM GG+FCNPY I +F+KNCPSL Sbjct: 304 GVFQEIQYCFVNVRELQLFMNGGIFCNPYHITMFLKNCPSL 344 >XP_014518059.1 PREDICTED: putative FBD-associated F-box protein At1g61330 [Vigna radiata var. radiata] Length = 482 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/50 (56%), Positives = 33/50 (66%) Frame = -3 Query: 151 QVLVASVCNGQFREAQCRLGNLIELQLFMEGGMFCNPYDIAVFIKNCPSL 2 + L A G F EA L NL+EL L MEGG+FCNPYDI F+K+CP L Sbjct: 306 EALTAKFRRGVFGEACYSLLNLMELHLVMEGGLFCNPYDILSFLKHCPLL 355 >XP_017435324.1 PREDICTED: putative FBD-associated F-box protein At1g61330 isoform X2 [Vigna angularis] Length = 400 Score = 55.5 bits (132), Expect = 6e-06 Identities = 26/48 (54%), Positives = 31/48 (64%) Frame = -3 Query: 151 QVLVASVCNGQFREAQCRLGNLIELQLFMEGGMFCNPYDIAVFIKNCP 8 + L A G F EA NL+EL L MEGG+FCNPYDI F+K+CP Sbjct: 306 EALTAKFRRGVFGEACYSFLNLMELHLIMEGGLFCNPYDILSFMKHCP 353 >XP_017435323.1 PREDICTED: putative FBD-associated F-box protein At1g61330 isoform X1 [Vigna angularis] KOM53839.1 hypothetical protein LR48_Vigan09g249800 [Vigna angularis] BAT87020.1 hypothetical protein VIGAN_05035700 [Vigna angularis var. angularis] Length = 482 Score = 55.5 bits (132), Expect = 6e-06 Identities = 26/48 (54%), Positives = 31/48 (64%) Frame = -3 Query: 151 QVLVASVCNGQFREAQCRLGNLIELQLFMEGGMFCNPYDIAVFIKNCP 8 + L A G F EA NL+EL L MEGG+FCNPYDI F+K+CP Sbjct: 306 EALTAKFRRGVFGEACYSFLNLMELHLIMEGGLFCNPYDILSFMKHCP 353 >XP_002316659.2 hypothetical protein POPTR_0011s04270g [Populus trichocarpa] EEE97271.2 hypothetical protein POPTR_0011s04270g [Populus trichocarpa] Length = 495 Score = 55.5 bits (132), Expect = 6e-06 Identities = 24/41 (58%), Positives = 29/41 (70%) Frame = -3 Query: 124 GQFREAQCRLGNLIELQLFMEGGMFCNPYDIAVFIKNCPSL 2 G+ RE Q GNL E L MEG ++CNPYDI F+K+CPSL Sbjct: 333 GKLREMQFFFGNLKEFHLIMEGAIYCNPYDIISFLKHCPSL 373 >KYP63000.1 Putative FBD-associated F-box protein At1g61330 family [Cajanus cajan] Length = 376 Score = 55.1 bits (131), Expect = 8e-06 Identities = 26/50 (52%), Positives = 30/50 (60%) Frame = -3 Query: 151 QVLVASVCNGQFREAQCRLGNLIELQLFMEGGMFCNPYDIAVFIKNCPSL 2 + L G F EA NL ELQL MEGG+FCNPYDI +F+ CP L Sbjct: 203 EALTTKFRRGVFGEANYSFLNLKELQLMMEGGLFCNPYDIVMFMMRCPLL 252