BLASTX nr result
ID: Glycyrrhiza28_contig00033549
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00033549 (296 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU43675.1 hypothetical protein TSUD_302380 [Trifolium subterran... 55 1e-06 >GAU43675.1 hypothetical protein TSUD_302380 [Trifolium subterraneum] Length = 523 Score = 55.1 bits (131), Expect = 1e-06 Identities = 36/70 (51%), Positives = 42/70 (60%), Gaps = 7/70 (10%) Frame = -2 Query: 193 SSCRSSSITFFHPYPLYPSHSLQLSLRSPSTS---YQPRPLFSLTLLRPQPPNNDY---- 35 SS SSS T FH YP SHSLQLS RS ST +Q + F L + QPPNN + Sbjct: 15 SSSSSSSSTTFHRYP---SHSLQLSFRSSSTLSPLFQTQHSFFSLLTKSQPPNNHFFRFR 71 Query: 34 FRFQPSTHAF 5 FRF+ STH+F Sbjct: 72 FRFRLSTHSF 81