BLASTX nr result
ID: Glycyrrhiza28_contig00033520
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00033520 (338 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU41990.1 hypothetical protein TSUD_306960 [Trifolium subterran... 58 2e-07 >GAU41990.1 hypothetical protein TSUD_306960 [Trifolium subterraneum] Length = 720 Score = 57.8 bits (138), Expect = 2e-07 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = +1 Query: 211 MGSVPVRYPFGIRFHSQPQGALPRRLDCSISQFPLHVDLSRI 336 MG+V R+PFGI FH Q +L RRL+CSISQFPLH DLSRI Sbjct: 1 MGTVSARHPFGIPFHFQ---SLNRRLECSISQFPLHFDLSRI 39