BLASTX nr result
ID: Glycyrrhiza28_contig00033515
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00033515 (253 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004491510.1 PREDICTED: putative pentatricopeptide repeat-cont... 66 8e-11 XP_003617808.1 pentatricopeptide (PPR) repeat protein [Medicago ... 63 1e-09 XP_003529187.2 PREDICTED: putative pentatricopeptide repeat-cont... 59 3e-08 XP_007153123.1 hypothetical protein PHAVU_003G008700g [Phaseolus... 57 1e-07 XP_014520247.1 PREDICTED: putative pentatricopeptide repeat-cont... 54 2e-06 XP_017426710.1 PREDICTED: putative pentatricopeptide repeat-cont... 54 2e-06 XP_016194443.1 PREDICTED: putative pentatricopeptide repeat-cont... 52 6e-06 XP_015962602.1 PREDICTED: putative pentatricopeptide repeat-cont... 52 6e-06 >XP_004491510.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Cicer arietinum] Length = 813 Score = 66.2 bits (160), Expect = 8e-11 Identities = 35/49 (71%), Positives = 38/49 (77%), Gaps = 1/49 (2%) Frame = -1 Query: 145 HIHHQPSSTCLGGAYALDSHSYAHMLQQTIRNG-DPNAGKRVHCHILKQ 2 HI HQ CL ALDSHSYAHMLQQ IRNG DPNAGK++HCHILK+ Sbjct: 22 HIQHQ-HQPCL---VALDSHSYAHMLQQIIRNGADPNAGKQLHCHILKR 66 >XP_003617808.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] AET00767.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 811 Score = 62.8 bits (151), Expect = 1e-09 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 1/49 (2%) Frame = -1 Query: 145 HIHHQPSSTCLGGAYALDSHSYAHMLQQTIRNG-DPNAGKRVHCHILKQ 2 +IHHQ CL ALDSHSYAHMLQQ IRNG DP AGK +HCHILK+ Sbjct: 22 NIHHQQ---CLS---ALDSHSYAHMLQQIIRNGADPIAGKHLHCHILKR 64 >XP_003529187.2 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Glycine max] KRH49498.1 hypothetical protein GLYMA_07G159200 [Glycine max] Length = 822 Score = 58.9 bits (141), Expect = 3e-08 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -1 Query: 106 AYALDSHSYAHMLQQTIRNGDPNAGKRVHCHILK 5 A +DSHSYA+MLQQ IRN DPNAGK +HCHILK Sbjct: 40 ALDMDSHSYANMLQQAIRNRDPNAGKSLHCHILK 73 >XP_007153123.1 hypothetical protein PHAVU_003G008700g [Phaseolus vulgaris] ESW25117.1 hypothetical protein PHAVU_003G008700g [Phaseolus vulgaris] Length = 806 Score = 57.0 bits (136), Expect = 1e-07 Identities = 28/48 (58%), Positives = 32/48 (66%) Frame = -1 Query: 145 HIHHQPSSTCLGGAYALDSHSYAHMLQQTIRNGDPNAGKRVHCHILKQ 2 H HHQ ALDS+SYA MLQQ IRN PN+GK +HCHILK+ Sbjct: 21 HFHHQD---------ALDSYSYATMLQQAIRNRHPNSGKSLHCHILKR 59 >XP_014520247.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Vigna radiata var. radiata] Length = 816 Score = 53.9 bits (128), Expect = 2e-06 Identities = 26/48 (54%), Positives = 31/48 (64%) Frame = -1 Query: 145 HIHHQPSSTCLGGAYALDSHSYAHMLQQTIRNGDPNAGKRVHCHILKQ 2 H HHQ ALDS+SYA MLQQ I+N +PN+GK HCHI K+ Sbjct: 31 HFHHQD---------ALDSYSYATMLQQAIQNRNPNSGKSFHCHIFKR 69 >XP_017426710.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Vigna angularis] KOM46162.1 hypothetical protein LR48_Vigan06g146800 [Vigna angularis] BAT98771.1 hypothetical protein VIGAN_10011500 [Vigna angularis var. angularis] Length = 816 Score = 53.9 bits (128), Expect = 2e-06 Identities = 26/48 (54%), Positives = 31/48 (64%) Frame = -1 Query: 145 HIHHQPSSTCLGGAYALDSHSYAHMLQQTIRNGDPNAGKRVHCHILKQ 2 H HHQ A DS+SYA MLQQ I+N +PN+GK HCHILK+ Sbjct: 31 HFHHQD---------AFDSYSYATMLQQAIQNRNPNSGKSFHCHILKR 69 >XP_016194443.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Arachis ipaensis] Length = 814 Score = 52.4 bits (124), Expect = 6e-06 Identities = 24/39 (61%), Positives = 31/39 (79%) Frame = -1 Query: 118 CLGGAYALDSHSYAHMLQQTIRNGDPNAGKRVHCHILKQ 2 CLG A DSHS+A LQ+TI++GD +AGKR+HCH LK+ Sbjct: 32 CLG---AFDSHSFASTLQRTIQDGDTDAGKRLHCHALKR 67 >XP_015962602.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Arachis duranensis] Length = 814 Score = 52.4 bits (124), Expect = 6e-06 Identities = 24/39 (61%), Positives = 31/39 (79%) Frame = -1 Query: 118 CLGGAYALDSHSYAHMLQQTIRNGDPNAGKRVHCHILKQ 2 CLG A DSHS+A LQ+TI++GD +AGKR+HCH LK+ Sbjct: 32 CLG---AFDSHSFASTLQRTIQDGDADAGKRLHCHALKR 67