BLASTX nr result
ID: Glycyrrhiza28_contig00033325
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00033325 (243 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP41486.1 Putative serine/threonine-protein kinase receptor [Ca... 64 6e-10 KDO74347.1 hypothetical protein CISIN_1g003391mg [Citrus sinensi... 61 4e-09 XP_006452075.1 hypothetical protein CICLE_v10007466mg [Citrus cl... 61 4e-09 KDO74346.1 hypothetical protein CISIN_1g003391mg [Citrus sinensis] 61 4e-09 XP_015384805.1 PREDICTED: G-type lectin S-receptor-like serine/t... 61 4e-09 AFK46444.1 unknown [Medicago truncatula] 59 7e-09 XP_006452080.1 hypothetical protein CICLE_v10007464mg [Citrus cl... 60 7e-09 KDO74353.1 hypothetical protein CISIN_1g003272mg [Citrus sinensis] 60 7e-09 XP_006475274.2 PREDICTED: uncharacterized protein LOC102626881 [... 60 7e-09 XP_017431687.1 PREDICTED: G-type lectin S-receptor-like serine/t... 59 2e-08 BAT89500.1 hypothetical protein VIGAN_06046900 [Vigna angularis ... 59 2e-08 XP_014490064.1 PREDICTED: G-type lectin S-receptor-like serine/t... 59 2e-08 XP_006598045.1 PREDICTED: G-type lectin S-receptor-like serine/t... 59 2e-08 XP_015938644.1 PREDICTED: uncharacterized protein LOC107464227 [... 59 2e-08 XP_004487641.1 PREDICTED: G-type lectin S-receptor-like serine/t... 59 3e-08 XP_003596526.1 S-locus lectin kinase family protein [Medicago tr... 59 3e-08 KRH25995.1 hypothetical protein GLYMA_12G144400 [Glycine max] 59 3e-08 KHN10132.1 G-type lectin S-receptor-like serine/threonine-protei... 59 3e-08 XP_006592575.1 PREDICTED: G-type lectin S-receptor-like serine/t... 59 3e-08 KHN47414.1 G-type lectin S-receptor-like serine/threonine-protei... 59 3e-08 >KYP41486.1 Putative serine/threonine-protein kinase receptor [Cajanus cajan] Length = 811 Score = 63.5 bits (153), Expect = 6e-10 Identities = 32/53 (60%), Positives = 37/53 (69%), Gaps = 1/53 (1%) Frame = +1 Query: 1 SVVLMLNGEKSLPKPKIPAFYNEKD-PPEKNSLSGKSKLFSNNDISHTVFEAR 156 S VLMLNG+K LPKPK+P FY E D PE N SG KLFS N++S T +AR Sbjct: 759 SAVLMLNGDKLLPKPKVPGFYTETDVKPETNCSSGNHKLFSVNEVSITTLDAR 811 >KDO74347.1 hypothetical protein CISIN_1g003391mg [Citrus sinensis] KDO74348.1 hypothetical protein CISIN_1g003391mg [Citrus sinensis] Length = 606 Score = 61.2 bits (147), Expect = 4e-09 Identities = 28/52 (53%), Positives = 38/52 (73%) Frame = +1 Query: 1 SVVLMLNGEKSLPKPKIPAFYNEKDPPEKNSLSGKSKLFSNNDISHTVFEAR 156 SVVLML+GE+SLP+PK P F+ E++PPE S S K L S N+I+ ++ E R Sbjct: 555 SVVLMLSGERSLPQPKQPGFFTERNPPESGSSSSKRSLLSTNEITISLIEGR 606 >XP_006452075.1 hypothetical protein CICLE_v10007466mg [Citrus clementina] ESR65315.1 hypothetical protein CICLE_v10007466mg [Citrus clementina] Length = 822 Score = 61.2 bits (147), Expect = 4e-09 Identities = 28/52 (53%), Positives = 38/52 (73%) Frame = +1 Query: 1 SVVLMLNGEKSLPKPKIPAFYNEKDPPEKNSLSGKSKLFSNNDISHTVFEAR 156 SVVLML+GE+SLP+PK P F+ E++PPE S S K L S N+I+ ++ E R Sbjct: 771 SVVLMLSGERSLPQPKQPGFFTERNPPESGSSSSKRSLLSTNEITISLIEGR 822 >KDO74346.1 hypothetical protein CISIN_1g003391mg [Citrus sinensis] Length = 823 Score = 61.2 bits (147), Expect = 4e-09 Identities = 28/52 (53%), Positives = 38/52 (73%) Frame = +1 Query: 1 SVVLMLNGEKSLPKPKIPAFYNEKDPPEKNSLSGKSKLFSNNDISHTVFEAR 156 SVVLML+GE+SLP+PK P F+ E++PPE S S K L S N+I+ ++ E R Sbjct: 772 SVVLMLSGERSLPQPKQPGFFTERNPPESGSSSSKRSLLSTNEITISLIEGR 823 >XP_015384805.1 PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 [Citrus sinensis] Length = 880 Score = 61.2 bits (147), Expect = 4e-09 Identities = 28/52 (53%), Positives = 38/52 (73%) Frame = +1 Query: 1 SVVLMLNGEKSLPKPKIPAFYNEKDPPEKNSLSGKSKLFSNNDISHTVFEAR 156 SVVLML+GE+SLP+PK P F+ E++PPE S S K L S N+I+ ++ E R Sbjct: 829 SVVLMLSGERSLPQPKQPGFFTERNPPESGSSSSKRSLLSTNEITISLIEGR 880 >AFK46444.1 unknown [Medicago truncatula] Length = 178 Score = 58.9 bits (141), Expect = 7e-09 Identities = 30/52 (57%), Positives = 39/52 (75%) Frame = +1 Query: 1 SVVLMLNGEKSLPKPKIPAFYNEKDPPEKNSLSGKSKLFSNNDISHTVFEAR 156 + VLMLNGEK+LPKPK PAF+ P + S SG +KL+SNN++S T+ EAR Sbjct: 131 AAVLMLNGEKALPKPKEPAFF----PHQFGSSSGTTKLYSNNEVSITMLEAR 178 >XP_006452080.1 hypothetical protein CICLE_v10007464mg [Citrus clementina] ESR65320.1 hypothetical protein CICLE_v10007464mg [Citrus clementina] Length = 822 Score = 60.5 bits (145), Expect = 7e-09 Identities = 29/52 (55%), Positives = 38/52 (73%) Frame = +1 Query: 1 SVVLMLNGEKSLPKPKIPAFYNEKDPPEKNSLSGKSKLFSNNDISHTVFEAR 156 SVVLML+GE+SLP+PK P F+ E++ PE S S K L S N+IS ++ EAR Sbjct: 771 SVVLMLSGERSLPQPKQPGFFTERNLPESESSSSKQNLSSTNEISFSMLEAR 822 >KDO74353.1 hypothetical protein CISIN_1g003272mg [Citrus sinensis] Length = 834 Score = 60.5 bits (145), Expect = 7e-09 Identities = 29/52 (55%), Positives = 38/52 (73%) Frame = +1 Query: 1 SVVLMLNGEKSLPKPKIPAFYNEKDPPEKNSLSGKSKLFSNNDISHTVFEAR 156 SVVLML+GE+SLP+PK P F+ E++ PE S S K L S N+IS ++ EAR Sbjct: 783 SVVLMLSGERSLPQPKQPGFFTERNLPESESSSSKQNLSSTNEISFSMLEAR 834 >XP_006475274.2 PREDICTED: uncharacterized protein LOC102626881 [Citrus sinensis] Length = 1681 Score = 60.5 bits (145), Expect = 7e-09 Identities = 29/52 (55%), Positives = 38/52 (73%) Frame = +1 Query: 1 SVVLMLNGEKSLPKPKIPAFYNEKDPPEKNSLSGKSKLFSNNDISHTVFEAR 156 SVVLML+GE+SLP+PK P F+ E++ PE S S K L S N+IS ++ EAR Sbjct: 789 SVVLMLSGERSLPQPKQPGFFTERNLPESESSSSKQNLSSTNEISFSMLEAR 840 Score = 55.8 bits (133), Expect = 3e-07 Identities = 27/52 (51%), Positives = 38/52 (73%) Frame = +1 Query: 1 SVVLMLNGEKSLPKPKIPAFYNEKDPPEKNSLSGKSKLFSNNDISHTVFEAR 156 SVVLML+GE+SLP+PK P F+ E++ PE S S K KL +N+I+ ++ E R Sbjct: 1630 SVVLMLSGERSLPQPKQPGFFTERNLPESESSSSKRKLPLSNEITISLIEGR 1681 >XP_017431687.1 PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 [Vigna angularis] KOM49384.1 hypothetical protein LR48_Vigan08g021100 [Vigna angularis] Length = 802 Score = 59.3 bits (142), Expect = 2e-08 Identities = 32/53 (60%), Positives = 37/53 (69%), Gaps = 1/53 (1%) Frame = +1 Query: 1 SVVLMLNGEKSLPKPKIPAFYNEKD-PPEKNSLSGKSKLFSNNDISHTVFEAR 156 SVVLMLNGEKSLPKPK+P FY E D E NS S L S N++S T+ +AR Sbjct: 750 SVVLMLNGEKSLPKPKVPGFYTESDVTTETNSSSENHTLCSVNELSITMIDAR 802 >BAT89500.1 hypothetical protein VIGAN_06046900 [Vigna angularis var. angularis] Length = 813 Score = 59.3 bits (142), Expect = 2e-08 Identities = 32/53 (60%), Positives = 37/53 (69%), Gaps = 1/53 (1%) Frame = +1 Query: 1 SVVLMLNGEKSLPKPKIPAFYNEKD-PPEKNSLSGKSKLFSNNDISHTVFEAR 156 SVVLMLNGEKSLPKPK+P FY E D E NS S L S N++S T+ +AR Sbjct: 761 SVVLMLNGEKSLPKPKVPGFYTESDVTTETNSSSENHTLCSVNELSITMIDAR 813 >XP_014490064.1 PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 [Vigna radiata var. radiata] Length = 813 Score = 59.3 bits (142), Expect = 2e-08 Identities = 32/53 (60%), Positives = 37/53 (69%), Gaps = 1/53 (1%) Frame = +1 Query: 1 SVVLMLNGEKSLPKPKIPAFYNEKD-PPEKNSLSGKSKLFSNNDISHTVFEAR 156 SVVLMLNGEKSLPKPK+P FY E D E NS S L S N++S T+ +AR Sbjct: 761 SVVLMLNGEKSLPKPKVPGFYTESDVTTETNSSSENHTLCSINELSITMIDAR 813 >XP_006598045.1 PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 [Glycine max] KRH13197.1 hypothetical protein GLYMA_15G221800 [Glycine max] Length = 820 Score = 59.3 bits (142), Expect = 2e-08 Identities = 32/53 (60%), Positives = 37/53 (69%), Gaps = 1/53 (1%) Frame = +1 Query: 1 SVVLMLNGEKSLPKPKIPAFYNEKD-PPEKNSLSGKSKLFSNNDISHTVFEAR 156 SVVLMLNG+K LPKPK+P FY E D E NS KL+S NDIS T+ +AR Sbjct: 768 SVVLMLNGDKLLPKPKVPGFYTETDNKSEANSSLENYKLYSVNDISITMLDAR 820 >XP_015938644.1 PREDICTED: uncharacterized protein LOC107464227 [Arachis duranensis] Length = 1540 Score = 59.3 bits (142), Expect = 2e-08 Identities = 31/53 (58%), Positives = 38/53 (71%), Gaps = 1/53 (1%) Frame = +1 Query: 1 SVVLMLNGEKSLPKPKIPAFYNEKDPP-EKNSLSGKSKLFSNNDISHTVFEAR 156 SVVLMLNGEK LPKPK+P FYN++ E +SL FS N+IS+T+ EAR Sbjct: 733 SVVLMLNGEKLLPKPKVPGFYNDRSVTLETDSLLKNYTSFSTNEISNTIAEAR 785 Score = 58.5 bits (140), Expect = 4e-08 Identities = 32/53 (60%), Positives = 36/53 (67%), Gaps = 1/53 (1%) Frame = +1 Query: 1 SVVLMLNGEKSLPKPKIPAFYNEKD-PPEKNSLSGKSKLFSNNDISHTVFEAR 156 SVVLMLNGEK LPKPK+P FY E+ PE +SL LFS N+IS T AR Sbjct: 1488 SVVLMLNGEKLLPKPKVPGFYTERGVTPEADSLMENYTLFSANEISITTLYAR 1540 >XP_004487641.1 PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 [Cicer arietinum] Length = 815 Score = 58.9 bits (141), Expect = 3e-08 Identities = 31/52 (59%), Positives = 39/52 (75%) Frame = +1 Query: 1 SVVLMLNGEKSLPKPKIPAFYNEKDPPEKNSLSGKSKLFSNNDISHTVFEAR 156 SVVLMLNGEK+LP+PK PAFY P + + SG SK+ SNN+IS T+ +AR Sbjct: 768 SVVLMLNGEKALPRPKEPAFY----PHQFGTSSGTSKMHSNNEISITLLQAR 815 >XP_003596526.1 S-locus lectin kinase family protein [Medicago truncatula] AES66777.1 S-locus lectin kinase family protein [Medicago truncatula] Length = 817 Score = 58.9 bits (141), Expect = 3e-08 Identities = 30/52 (57%), Positives = 39/52 (75%) Frame = +1 Query: 1 SVVLMLNGEKSLPKPKIPAFYNEKDPPEKNSLSGKSKLFSNNDISHTVFEAR 156 + VLMLNGEK+LPKPK PAF+ P + S SG +KL+SNN++S T+ EAR Sbjct: 770 AAVLMLNGEKALPKPKEPAFF----PHQFGSSSGTTKLYSNNEVSITMLEAR 817 >KRH25995.1 hypothetical protein GLYMA_12G144400 [Glycine max] Length = 632 Score = 58.5 bits (140), Expect = 3e-08 Identities = 30/52 (57%), Positives = 34/52 (65%) Frame = +1 Query: 1 SVVLMLNGEKSLPKPKIPAFYNEKDPPEKNSLSGKSKLFSNNDISHTVFEAR 156 SV+ MLNGEK LP+PK P FY K PE S S K S N+IS T+FEAR Sbjct: 581 SVIPMLNGEKLLPQPKAPGFYTGKCTPESVSSSKTCKFLSQNEISLTIFEAR 632 >KHN10132.1 G-type lectin S-receptor-like serine/threonine-protein kinase [Glycine soja] Length = 806 Score = 58.5 bits (140), Expect = 3e-08 Identities = 31/53 (58%), Positives = 37/53 (69%), Gaps = 1/53 (1%) Frame = +1 Query: 1 SVVLMLNGEKSLPKPKIPAFYNEKD-PPEKNSLSGKSKLFSNNDISHTVFEAR 156 SVVLMLNG+K LPKPK+P FY E D E NS KL+S ND+S T+ +AR Sbjct: 754 SVVLMLNGDKLLPKPKVPGFYTETDNKSEANSSLENYKLYSVNDLSITMLDAR 806 >XP_006592575.1 PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 isoform X2 [Glycine max] KRH25993.1 hypothetical protein GLYMA_12G144400 [Glycine max] Length = 819 Score = 58.5 bits (140), Expect = 3e-08 Identities = 30/52 (57%), Positives = 34/52 (65%) Frame = +1 Query: 1 SVVLMLNGEKSLPKPKIPAFYNEKDPPEKNSLSGKSKLFSNNDISHTVFEAR 156 SV+ MLNGEK LP+PK P FY K PE S S K S N+IS T+FEAR Sbjct: 768 SVIPMLNGEKLLPQPKAPGFYTGKCTPESVSSSKTCKFLSQNEISLTIFEAR 819 >KHN47414.1 G-type lectin S-receptor-like serine/threonine-protein kinase [Glycine soja] Length = 820 Score = 58.5 bits (140), Expect = 3e-08 Identities = 30/52 (57%), Positives = 34/52 (65%) Frame = +1 Query: 1 SVVLMLNGEKSLPKPKIPAFYNEKDPPEKNSLSGKSKLFSNNDISHTVFEAR 156 SV+ MLNGEK LP+PK P FY K PE S S K S N+IS T+FEAR Sbjct: 769 SVIPMLNGEKLLPQPKAPGFYTGKCTPESVSSSKTCKFLSQNEISLTIFEAR 820