BLASTX nr result
ID: Glycyrrhiza28_contig00033111
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00033111 (373 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017424931.1 PREDICTED: putative pentatricopeptide repeat-cont... 69 4e-11 OIW08337.1 hypothetical protein TanjilG_03013 [Lupinus angustifo... 68 9e-11 XP_019449048.1 PREDICTED: putative pentatricopeptide repeat-cont... 68 9e-11 KYP50404.1 Putative pentatricopeptide repeat-containing protein ... 65 6e-10 XP_007150840.1 hypothetical protein PHAVU_005G185300g [Phaseolus... 65 1e-09 XP_014501192.1 PREDICTED: putative pentatricopeptide repeat-cont... 65 1e-09 XP_009379228.1 PREDICTED: putative pentatricopeptide repeat-cont... 59 1e-07 XP_014627345.1 PREDICTED: putative pentatricopeptide repeat-cont... 59 2e-07 KRG93487.1 hypothetical protein GLYMA_19G019400 [Glycine max] 59 2e-07 XP_014625221.1 PREDICTED: putative pentatricopeptide repeat-cont... 57 3e-07 XP_014625206.1 PREDICTED: putative pentatricopeptide repeat-cont... 57 4e-07 XP_006465137.1 PREDICTED: putative pentatricopeptide repeat-cont... 55 3e-06 XP_008380383.1 PREDICTED: putative pentatricopeptide repeat-cont... 55 3e-06 KDO46846.1 hypothetical protein CISIN_1g006437mg [Citrus sinensis] 54 5e-06 XP_018677577.1 PREDICTED: putative pentatricopeptide repeat-cont... 54 7e-06 >XP_017424931.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Vigna angularis] XP_017424932.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Vigna angularis] Length = 656 Score = 68.9 bits (167), Expect = 4e-11 Identities = 41/92 (44%), Positives = 55/92 (59%) Frame = -2 Query: 279 MIWSWLGSSKQMKKTITRFTTHTQPQTLAAFSSQFPMMSSKRRSEVVLKSESVRWTLSSC 100 MIWSW+ K T + + S+ K++ + + S+S++ T+S C Sbjct: 1 MIWSWMWRRKG-----TGLGWRLRLMQCHSSSAWCCGQRQKQKEKQRVNSQSLKLTVSRC 55 Query: 99 PSDLIALSFFLWSAQRRRRHDSVALDHMVAVL 4 PSDLIALSFFLW+AQ RRRHD VALDH+V VL Sbjct: 56 PSDLIALSFFLWTAQ-RRRHDLVALDHIVTVL 86 >OIW08337.1 hypothetical protein TanjilG_03013 [Lupinus angustifolius] Length = 652 Score = 67.8 bits (164), Expect = 9e-11 Identities = 38/63 (60%), Positives = 44/63 (69%), Gaps = 1/63 (1%) Frame = -2 Query: 189 FSSQFPMMSSKRRSEVVLKSESVRWTLSSCPSDLIALSFFLWSAQRRR-RHDSVALDHMV 13 F S FP K ++ V+L ++V TLS CPSDLIALSFFLWSAQR HDS+ALD MV Sbjct: 37 FPSPFP---HKTKTNVLLNRDNVHSTLSKCPSDLIALSFFLWSAQRHGCSHDSLALDRMV 93 Query: 12 AVL 4 VL Sbjct: 94 TVL 96 >XP_019449048.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Lupinus angustifolius] XP_019449049.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Lupinus angustifolius] XP_019449050.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Lupinus angustifolius] Length = 697 Score = 67.8 bits (164), Expect = 9e-11 Identities = 38/63 (60%), Positives = 44/63 (69%), Gaps = 1/63 (1%) Frame = -2 Query: 189 FSSQFPMMSSKRRSEVVLKSESVRWTLSSCPSDLIALSFFLWSAQRRR-RHDSVALDHMV 13 F S FP K ++ V+L ++V TLS CPSDLIALSFFLWSAQR HDS+ALD MV Sbjct: 82 FPSPFP---HKTKTNVLLNRDNVHSTLSKCPSDLIALSFFLWSAQRHGCSHDSLALDRMV 138 Query: 12 AVL 4 VL Sbjct: 139 TVL 141 >KYP50404.1 Putative pentatricopeptide repeat-containing protein At1g16830 family [Cajanus cajan] Length = 647 Score = 65.5 bits (158), Expect = 6e-10 Identities = 40/92 (43%), Positives = 51/92 (55%) Frame = -2 Query: 279 MIWSWLGSSKQMKKTITRFTTHTQPQTLAAFSSQFPMMSSKRRSEVVLKSESVRWTLSSC 100 MIWSWL +S ++ + T + Q S K++ +V +WTLS Sbjct: 1 MIWSWLWASTGIRIGLRLKRTQRVGGCVVCLCHQCDYSSQKQKGKV-------KWTLSRS 53 Query: 99 PSDLIALSFFLWSAQRRRRHDSVALDHMVAVL 4 PSDL+ALS FLWSAQ RR D+VALD MV VL Sbjct: 54 PSDLVALSLFLWSAQ-RRHPDTVALDDMVTVL 84 >XP_007150840.1 hypothetical protein PHAVU_005G185300g [Phaseolus vulgaris] ESW22834.1 hypothetical protein PHAVU_005G185300g [Phaseolus vulgaris] Length = 653 Score = 64.7 bits (156), Expect = 1e-09 Identities = 41/92 (44%), Positives = 53/92 (57%) Frame = -2 Query: 279 MIWSWLGSSKQMKKTITRFTTHTQPQTLAAFSSQFPMMSSKRRSEVVLKSESVRWTLSSC 100 MIWSWL K + R + SS +R+ + V S+S++ T+S C Sbjct: 1 MIWSWLWRRKGIIGWRLR--------PMQCHSSSSASWCGQRQKQKV-NSQSLKRTVSRC 51 Query: 99 PSDLIALSFFLWSAQRRRRHDSVALDHMVAVL 4 PSDLIALSFFLW+AQRRR H + LDH+V VL Sbjct: 52 PSDLIALSFFLWTAQRRRHH-LLPLDHIVTVL 82 >XP_014501192.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Vigna radiata var. radiata] Length = 656 Score = 64.7 bits (156), Expect = 1e-09 Identities = 38/92 (41%), Positives = 53/92 (57%) Frame = -2 Query: 279 MIWSWLGSSKQMKKTITRFTTHTQPQTLAAFSSQFPMMSSKRRSEVVLKSESVRWTLSSC 100 MIWSW+ K T + + S+ K++ + + S+S++ T+S C Sbjct: 1 MIWSWMCRRKG-----TGIGWRLRLMQCHSSSAWCCGQKQKQKEKQRVNSQSLKLTVSRC 55 Query: 99 PSDLIALSFFLWSAQRRRRHDSVALDHMVAVL 4 PSDLIALS FLW+AQ RRRHD A+DH+V VL Sbjct: 56 PSDLIALSLFLWTAQ-RRRHDMAAIDHIVTVL 86 >XP_009379228.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Pyrus x bretschneideri] XP_009379232.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Pyrus x bretschneideri] XP_009379233.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Pyrus x bretschneideri] XP_009379236.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Pyrus x bretschneideri] XP_009379237.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Pyrus x bretschneideri] XP_009379238.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Pyrus x bretschneideri] XP_009379239.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Pyrus x bretschneideri] XP_018507949.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Pyrus x bretschneideri] Length = 663 Score = 58.9 bits (141), Expect = 1e-07 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 1/59 (1%) Frame = -2 Query: 177 FPMMSSKRRSEVVLKSESVRWTLSSCPSDLIALSFFLWSA-QRRRRHDSVALDHMVAVL 4 FP + + RSE++L + V TL C SDLIAL FFLW A QR H+ + +DHMV V+ Sbjct: 46 FPKIFDRERSELILNHQVVHSTLLKCSSDLIALRFFLWCAGQRNYFHNKIVIDHMVGVI 104 >XP_014627345.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Glycine max] XP_014627346.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Glycine max] XP_014627347.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Glycine max] XP_014627348.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Glycine max] XP_014627349.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Glycine max] XP_014627350.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Glycine max] XP_014627351.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Glycine max] Length = 599 Score = 58.5 bits (140), Expect = 2e-07 Identities = 35/54 (64%), Positives = 37/54 (68%) Frame = -2 Query: 165 SSKRRSEVVLKSESVRWTLSSCPSDLIALSFFLWSAQRRRRHDSVALDHMVAVL 4 SSK R + SES LS CPSDLIALS FLWSAQ RRRHDS A D +V VL Sbjct: 24 SSKWRRRNTVNSES----LSRCPSDLIALSLFLWSAQ-RRRHDSFAFDRIVTVL 72 >KRG93487.1 hypothetical protein GLYMA_19G019400 [Glycine max] Length = 603 Score = 58.5 bits (140), Expect = 2e-07 Identities = 35/54 (64%), Positives = 37/54 (68%) Frame = -2 Query: 165 SSKRRSEVVLKSESVRWTLSSCPSDLIALSFFLWSAQRRRRHDSVALDHMVAVL 4 SSK R + SES LS CPSDLIALS FLWSAQ RRRHDS A D +V VL Sbjct: 24 SSKWRRRNTVNSES----LSRCPSDLIALSLFLWSAQ-RRRHDSFAFDRIVTVL 72 >XP_014625221.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X2 [Glycine max] Length = 338 Score = 57.4 bits (137), Expect = 3e-07 Identities = 34/54 (62%), Positives = 36/54 (66%) Frame = -2 Query: 165 SSKRRSEVVLKSESVRWTLSSCPSDLIALSFFLWSAQRRRRHDSVALDHMVAVL 4 SSK R + SE TLS CPSDLIA S FLWSAQ RRRHDS A D +V VL Sbjct: 24 SSKWRRRNTVNSE----TLSRCPSDLIAFSLFLWSAQ-RRRHDSFAFDRIVTVL 72 >XP_014625206.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625207.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625208.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625209.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625210.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625211.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625212.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625213.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625214.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625215.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625216.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625217.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625218.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625219.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625220.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] KRH05318.1 hypothetical protein GLYMA_17G219900 [Glycine max] Length = 643 Score = 57.4 bits (137), Expect = 4e-07 Identities = 34/54 (62%), Positives = 36/54 (66%) Frame = -2 Query: 165 SSKRRSEVVLKSESVRWTLSSCPSDLIALSFFLWSAQRRRRHDSVALDHMVAVL 4 SSK R + SE TLS CPSDLIA S FLWSAQ RRRHDS A D +V VL Sbjct: 24 SSKWRRRNTVNSE----TLSRCPSDLIAFSLFLWSAQ-RRRHDSFAFDRIVTVL 72 >XP_006465137.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Citrus sinensis] XP_006465138.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Citrus sinensis] XP_006465139.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Citrus sinensis] XP_015384676.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Citrus sinensis] XP_015384678.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Citrus sinensis] XP_015384682.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Citrus sinensis] XP_015384686.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Citrus sinensis] XP_015384687.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Citrus sinensis] XP_015384692.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Citrus sinensis] Length = 645 Score = 55.1 bits (131), Expect = 3e-06 Identities = 35/87 (40%), Positives = 48/87 (55%), Gaps = 4/87 (4%) Frame = -2 Query: 249 QMKKTITRFTTHTQ---PQTLAAFSSQFPMMSSKRRSEVVLKSESVRWTLSSCPSDLIAL 79 Q+ KTI F + Q P+ A FP ++L + V TL +CPSDLIAL Sbjct: 17 QILKTIISFKSIHQISSPKVCATTHQDFP---------IILAPQIVHSTLLNCPSDLIAL 67 Query: 78 SFFLWSA-QRRRRHDSVALDHMVAVLS 1 SFF+W A QR HD + DHM++V++ Sbjct: 68 SFFIWCAKQRDYFHDVQSFDHMISVVT 94 >XP_008380383.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Malus domestica] XP_008380384.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Malus domestica] XP_008380385.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Malus domestica] XP_008380386.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Malus domestica] XP_008380387.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Malus domestica] XP_008380388.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Malus domestica] XP_008380390.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Malus domestica] XP_008380391.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Malus domestica] XP_017189981.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Malus domestica] Length = 663 Score = 55.1 bits (131), Expect = 3e-06 Identities = 27/59 (45%), Positives = 38/59 (64%), Gaps = 1/59 (1%) Frame = -2 Query: 177 FPMMSSKRRSEVVLKSESVRWTLSSCPSDLIALSFFLWSA-QRRRRHDSVALDHMVAVL 4 F + + +SE++L + V TL +C SDLIAL FFLW A QR H+ + +DHMV V+ Sbjct: 46 FQKIFDREKSELILNHQVVHSTLLNCSSDLIALRFFLWCAGQRNYFHNKIVIDHMVGVI 104 >KDO46846.1 hypothetical protein CISIN_1g006437mg [Citrus sinensis] Length = 645 Score = 54.3 bits (129), Expect = 5e-06 Identities = 35/87 (40%), Positives = 47/87 (54%), Gaps = 4/87 (4%) Frame = -2 Query: 249 QMKKTITRFTTHTQ---PQTLAAFSSQFPMMSSKRRSEVVLKSESVRWTLSSCPSDLIAL 79 Q+ KTI F + Q P+ A FP ++L V TL +CPSDLIAL Sbjct: 17 QILKTIISFKSIHQISSPKVCATTHQDFP---------IILAPHIVHSTLLNCPSDLIAL 67 Query: 78 SFFLWSA-QRRRRHDSVALDHMVAVLS 1 SFF+W A QR HD + DHM++V++ Sbjct: 68 SFFIWCAKQRDYFHDVQSFDHMISVVT 94 >XP_018677577.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Musa acuminata subsp. malaccensis] Length = 641 Score = 53.9 bits (128), Expect = 7e-06 Identities = 35/78 (44%), Positives = 43/78 (55%), Gaps = 1/78 (1%) Frame = -2 Query: 234 ITRFTTHTQPQTLAAFSSQFPMMSSKRRSEVVLKSESVRWTLSSCPSDLIALSFFLWSA- 58 + R T H ++ AFS Q P S + L E V T+SSCPSD IALSFFLW A Sbjct: 8 LCRLTPHRAFESPRAFSIQSP-----DSSRLQLCPEIVESTVSSCPSDTIALSFFLWCAR 62 Query: 57 QRRRRHDSVALDHMVAVL 4 Q HDS + D M+ V+ Sbjct: 63 QPNYFHDSCSFDRMIPVV 80