BLASTX nr result
ID: Glycyrrhiza28_contig00032951
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00032951 (282 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_005090496.1 cytochrome c biogenesis B (mitochondrion) [Lotus ... 82 2e-17 YP_005090435.1 cytochrome c biogenesis B (mitochondrion) [Millet... 80 9e-17 JAT62308.1 Putative cytochrome c biogenesis ccmB-like mitochondr... 79 3e-16 YP_717148.1 cytochrome c biogenesis ccmB [Brassica napus] BAC988... 79 3e-16 ANS54526.1 cytochrome c biogenesis B (mitochondrion) [Cynomorium... 78 7e-16 P93280.2 RecName: Full=Putative cytochrome c biogenesis ccmB-lik... 78 7e-16 pir||S78218 probable heme transport protein - evening primrose m... 78 7e-16 AKJ25468.1 cytochrome c maturase subunit B (mitochondrion) [Gera... 78 7e-16 AKJ25464.1 cytochrome c maturase subunit B (mitochondrion) [Erod... 78 7e-16 AKJ25463.1 cytochrome c maturase subunit B (mitochondrion) [Cali... 78 7e-16 BAD83549.2 cytochrome c maturation protein CcmB (mitochondrion) ... 78 7e-16 YP_003587369.1 cytochrome c biogenesis B [Cucurbita pepo] ACV966... 78 1e-15 AKJ25482.1 cytochrome c maturase subunit B (mitochondrion) [Mons... 77 1e-15 AKJ25477.1 cytochrome c maturase subunit B (mitochondrion) [Gera... 77 1e-15 YP_009137034.1 cytochrome c biogenesis B (mitochondrion) [Gerani... 77 1e-15 AKJ25480.1 cytochrome c maturase subunit B (mitochondrion) [Gera... 77 2e-15 AKJ25466.1 cytochrome c maturase subunit B (mitochondrion) [Gera... 77 2e-15 AKJ25465.1 cytochrome c maturase subunit B (mitochondrion) [Gera... 77 2e-15 YP_003875505.1 cytochrome c biogenesis B (mitochondrion) [Silene... 77 2e-15 NP_064031.2 ccb206 gene product (mitochondrion) [Beta vulgaris s... 77 2e-15 >YP_005090496.1 cytochrome c biogenesis B (mitochondrion) [Lotus japonicus] AET62956.1 cytochrome c biogenesis B (mitochondrion) [Lotus japonicus] Length = 206 Score = 82.0 bits (201), Expect = 2e-17 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +3 Query: 3 LTVFCTSIETEWFHVLLLIGYFFLFVSLFPIVVSMSLQD 119 LTVFCTSIETEWFHVLLLIGYFFLFVSLFPIVVSMSLQD Sbjct: 168 LTVFCTSIETEWFHVLLLIGYFFLFVSLFPIVVSMSLQD 206 >YP_005090435.1 cytochrome c biogenesis B (mitochondrion) [Millettia pinnata] AET62895.1 cytochrome c biogenesis B (mitochondrion) [Millettia pinnata] Length = 206 Score = 80.5 bits (197), Expect = 9e-17 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +3 Query: 3 LTVFCTSIETEWFHVLLLIGYFFLFVSLFPIVVSMSLQD 119 LTVFCTSIET+WFHVLLLIGYFFLFVSLFPIVVSMSLQD Sbjct: 168 LTVFCTSIETKWFHVLLLIGYFFLFVSLFPIVVSMSLQD 206 >JAT62308.1 Putative cytochrome c biogenesis ccmB-like mitochondrial protein [Anthurium amnicola] Length = 206 Score = 79.3 bits (194), Expect = 3e-16 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = +3 Query: 3 LTVFCTSIETEWFHVLLLIGYFFLFVSLFPIVVSMSLQD 119 LTVFCTSIETEWFHVLLLIGYFFLFVSLFPI+VS+SLQD Sbjct: 168 LTVFCTSIETEWFHVLLLIGYFFLFVSLFPILVSISLQD 206 >YP_717148.1 cytochrome c biogenesis ccmB [Brassica napus] BAC98897.1 cytochrome c biogenesis ccmB (mitochondrion) [Brassica napus] Length = 206 Score = 79.3 bits (194), Expect = 3e-16 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = +3 Query: 3 LTVFCTSIETEWFHVLLLIGYFFLFVSLFPIVVSMSLQD 119 LTVFCTSIETEWFHVLLLIGYFFLFVSLFPI+VS+SLQD Sbjct: 168 LTVFCTSIETEWFHVLLLIGYFFLFVSLFPILVSISLQD 206 >ANS54526.1 cytochrome c biogenesis B (mitochondrion) [Cynomorium coccineum] Length = 206 Score = 78.2 bits (191), Expect = 7e-16 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = +3 Query: 3 LTVFCTSIETEWFHVLLLIGYFFLFVSLFPIVVSMSLQD 119 LT+FCTSIETEWFHVLLLIGYFFLFVSLFPI+VS+SLQD Sbjct: 168 LTLFCTSIETEWFHVLLLIGYFFLFVSLFPILVSISLQD 206 >P93280.2 RecName: Full=Putative cytochrome c biogenesis ccmB-like mitochondrial protein; AltName: Full=ABC transporter I family member 2; Short=ABC transporter ABCI.2; Short=AtABCI2 Length = 206 Score = 78.2 bits (191), Expect = 7e-16 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +3 Query: 3 LTVFCTSIETEWFHVLLLIGYFFLFVSLFPIVVSMSLQD 119 LTVFCTSIETEWFHVLLLIGYFFLFVSLFPI VS+SLQD Sbjct: 168 LTVFCTSIETEWFHVLLLIGYFFLFVSLFPISVSISLQD 206 >pir||S78218 probable heme transport protein - evening primrose mitochondrion (mitochondrion) [Oenothera villaricae] Length = 206 Score = 78.2 bits (191), Expect = 7e-16 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = +3 Query: 3 LTVFCTSIETEWFHVLLLIGYFFLFVSLFPIVVSMSLQD 119 LT+FCTSIETEWFHVLLLIGYFFLFVSLFPI+VS+SLQD Sbjct: 168 LTLFCTSIETEWFHVLLLIGYFFLFVSLFPILVSISLQD 206 >AKJ25468.1 cytochrome c maturase subunit B (mitochondrion) [Geranium macrorrhizum] Length = 206 Score = 78.2 bits (191), Expect = 7e-16 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = +3 Query: 3 LTVFCTSIETEWFHVLLLIGYFFLFVSLFPIVVSMSLQD 119 LT+FCTSIETEWFHVLLLIGYFFLFVSLFPI+VS+SLQD Sbjct: 168 LTLFCTSIETEWFHVLLLIGYFFLFVSLFPILVSISLQD 206 >AKJ25464.1 cytochrome c maturase subunit B (mitochondrion) [Erodium texanum] Length = 206 Score = 78.2 bits (191), Expect = 7e-16 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = +3 Query: 3 LTVFCTSIETEWFHVLLLIGYFFLFVSLFPIVVSMSLQD 119 LT+FCTSIETEWFHVLLLIGYFFLFVSLFPI+VS+SLQD Sbjct: 168 LTLFCTSIETEWFHVLLLIGYFFLFVSLFPILVSISLQD 206 >AKJ25463.1 cytochrome c maturase subunit B (mitochondrion) [California macrophylla] Length = 206 Score = 78.2 bits (191), Expect = 7e-16 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = +3 Query: 3 LTVFCTSIETEWFHVLLLIGYFFLFVSLFPIVVSMSLQD 119 LT+FCTSIETEWFHVLLLIGYFFLFVSLFPI+VS+SLQD Sbjct: 168 LTLFCTSIETEWFHVLLLIGYFFLFVSLFPILVSISLQD 206 >BAD83549.2 cytochrome c maturation protein CcmB (mitochondrion) [Nicotiana tabacum] Length = 206 Score = 78.2 bits (191), Expect = 7e-16 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = +3 Query: 3 LTVFCTSIETEWFHVLLLIGYFFLFVSLFPIVVSMSLQD 119 LT+FCTSIETEWFHVLLLIGYFFLFVSLFPI+VS+SLQD Sbjct: 168 LTLFCTSIETEWFHVLLLIGYFFLFVSLFPILVSISLQD 206 >YP_003587369.1 cytochrome c biogenesis B [Cucurbita pepo] ACV96667.1 cytochrome c biogenesis B (mitochondrion) [Cucurbita pepo] Length = 206 Score = 77.8 bits (190), Expect = 1e-15 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +3 Query: 3 LTVFCTSIETEWFHVLLLIGYFFLFVSLFPIVVSMSLQD 119 LT+FCTSIETEWFHVLLLIGYFFLFVSLFPI VS+SLQD Sbjct: 168 LTLFCTSIETEWFHVLLLIGYFFLFVSLFPIAVSISLQD 206 >AKJ25482.1 cytochrome c maturase subunit B (mitochondrion) [Monsonia emarginata] Length = 206 Score = 77.4 bits (189), Expect = 1e-15 Identities = 35/39 (89%), Positives = 39/39 (100%) Frame = +3 Query: 3 LTVFCTSIETEWFHVLLLIGYFFLFVSLFPIVVSMSLQD 119 LT+FCTSIETEWFHVLLLIGYFFLFVS+FPI+VS+SLQD Sbjct: 168 LTLFCTSIETEWFHVLLLIGYFFLFVSIFPILVSISLQD 206 >AKJ25477.1 cytochrome c maturase subunit B (mitochondrion) [Geranium robertianum] AKJ25481.1 cytochrome c maturase subunit B (mitochondrion) [Geranium yeoi] Length = 206 Score = 77.4 bits (189), Expect = 1e-15 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +3 Query: 3 LTVFCTSIETEWFHVLLLIGYFFLFVSLFPIVVSMSLQD 119 LT+FCTSIETEWFHVLLLIGYFFLFVSLFPI VS+SLQD Sbjct: 168 LTLFCTSIETEWFHVLLLIGYFFLFVSLFPIFVSISLQD 206 >YP_009137034.1 cytochrome c biogenesis B (mitochondrion) [Geranium maderense] AKE32271.1 cytochrome c biogenesis B (mitochondrion) [Geranium maderense] AKJ25469.1 cytochrome c maturase subunit B (mitochondrion) [Geranium maderense] Length = 206 Score = 77.4 bits (189), Expect = 1e-15 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +3 Query: 3 LTVFCTSIETEWFHVLLLIGYFFLFVSLFPIVVSMSLQD 119 LT+FCTSIETEWFHVLLLIGYFFLFVSLFPI VS+SLQD Sbjct: 168 LTLFCTSIETEWFHVLLLIGYFFLFVSLFPIFVSISLQD 206 >AKJ25480.1 cytochrome c maturase subunit B (mitochondrion) [Geranium traversii] Length = 206 Score = 77.0 bits (188), Expect = 2e-15 Identities = 35/39 (89%), Positives = 39/39 (100%) Frame = +3 Query: 3 LTVFCTSIETEWFHVLLLIGYFFLFVSLFPIVVSMSLQD 119 LT+FCTSIETEWFHVLLLIGYFFLF+SLFPI+VS+SLQD Sbjct: 168 LTLFCTSIETEWFHVLLLIGYFFLFLSLFPILVSISLQD 206 >AKJ25466.1 cytochrome c maturase subunit B (mitochondrion) [Geranium endressii] AKJ25470.1 cytochrome c maturase subunit B (mitochondrion) [Geranium nodosum] AKJ25471.1 cytochrome c maturase subunit B (mitochondrion) [Geranium platyanthum] AKJ25473.1 cytochrome c maturase subunit B (mitochondrion) [Geranium pratense] AKJ25474.1 cytochrome c maturase subunit B (mitochondrion) [Geranium platypetalum] AKJ25476.1 cytochrome c maturase subunit B (mitochondrion) [Geranium renardii] AKJ25478.1 cytochrome c maturase subunit B (mitochondrion) [Geranium subcaulescens] AKJ25479.1 cytochrome c maturase subunit B (mitochondrion) [Geranium sanguineum] Length = 206 Score = 77.0 bits (188), Expect = 2e-15 Identities = 35/39 (89%), Positives = 39/39 (100%) Frame = +3 Query: 3 LTVFCTSIETEWFHVLLLIGYFFLFVSLFPIVVSMSLQD 119 LT+FCTSIETEWFHVLLLIGYFFLF+SLFPI+VS+SLQD Sbjct: 168 LTLFCTSIETEWFHVLLLIGYFFLFLSLFPILVSISLQD 206 >AKJ25465.1 cytochrome c maturase subunit B (mitochondrion) [Geranium brycei] AKJ25467.1 cytochrome c maturase subunit B (mitochondrion) [Geranium incanum] AKM22499.1 cytochrome c maturase subunit B (mitochondrion) [Geranium brycei] Length = 206 Score = 77.0 bits (188), Expect = 2e-15 Identities = 35/39 (89%), Positives = 39/39 (100%) Frame = +3 Query: 3 LTVFCTSIETEWFHVLLLIGYFFLFVSLFPIVVSMSLQD 119 LT+FCTSIETEWFHVLLLIGYFFLF+SLFPI+VS+SLQD Sbjct: 168 LTLFCTSIETEWFHVLLLIGYFFLFLSLFPILVSISLQD 206 >YP_003875505.1 cytochrome c biogenesis B (mitochondrion) [Silene latifolia] ADG85300.1 cytochrome c biogenesis B (mitochondrion) [Silene latifolia] ADK73311.1 cytochrome c biogenesis B (mitochondrion) [Silene latifolia] Length = 206 Score = 77.0 bits (188), Expect = 2e-15 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +3 Query: 3 LTVFCTSIETEWFHVLLLIGYFFLFVSLFPIVVSMSLQD 119 LTVFCTSIETEWFHVLLLIGYFFLFVSLFPI+VS+S QD Sbjct: 168 LTVFCTSIETEWFHVLLLIGYFFLFVSLFPILVSISSQD 206 >NP_064031.2 ccb206 gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] YP_004222274.1 cytochrome c maturation protein CcmB (mitochondrion) [Beta vulgaris subsp. maritima] YP_004842081.1 cytochrome c maturation protein CcmB (mitochondrion) [Beta macrocarpa] ABD36061.1 cytochrome c biogenesis B (mitochondrion) [Beta vulgaris subsp. vulgaris] BAA99342.2 cytochrome c biogenesis protein (mitochondrion) [Beta vulgaris subsp. vulgaris] CBJ14097.1 cytochrome c biogenesis (mitochondrion) [Beta vulgaris subsp. maritima] CBJ17506.1 cytochrome c maturation protein CcmB (mitochondrion) [Beta vulgaris subsp. maritima] CBJ23362.1 cytochrome c maturation protein CcmB (mitochondrion) [Beta vulgaris subsp. maritima] CBX24883.1 cytochrome c maturation protein CcmB (mitochondrion) [Beta macrocarpa] CBL52048.1 cytochrome c maturation protein CcmB (mitochondrion) [Beta vulgaris subsp. maritima] Length = 206 Score = 77.0 bits (188), Expect = 2e-15 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +3 Query: 3 LTVFCTSIETEWFHVLLLIGYFFLFVSLFPIVVSMSLQD 119 LTVFCTSIETEWFHVLLLIGYFFLFVSLFPI+VS+S QD Sbjct: 168 LTVFCTSIETEWFHVLLLIGYFFLFVSLFPILVSISSQD 206