BLASTX nr result
ID: Glycyrrhiza28_contig00032891
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00032891 (265 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016901584.1 PREDICTED: pentatricopeptide repeat-containing pr... 100 6e-23 XP_004152207.1 PREDICTED: pentatricopeptide repeat-containing pr... 100 6e-23 XP_004486679.1 PREDICTED: pentatricopeptide repeat-containing pr... 99 2e-22 XP_019457215.1 PREDICTED: pentatricopeptide repeat-containing pr... 98 2e-22 XP_007215496.1 hypothetical protein PRUPE_ppa006834mg [Prunus pe... 97 4e-22 ONI16180.1 hypothetical protein PRUPE_3G083000 [Prunus persica] 97 4e-22 XP_016652143.1 PREDICTED: pentatricopeptide repeat-containing pr... 97 4e-22 XP_010278842.1 PREDICTED: pentatricopeptide repeat-containing pr... 97 4e-22 XP_002517613.1 PREDICTED: pentatricopeptide repeat-containing pr... 97 4e-22 OAY52837.1 hypothetical protein MANES_04G115200 [Manihot esculenta] 97 4e-22 XP_010097248.1 hypothetical protein L484_025797 [Morus notabilis... 97 4e-22 XP_009343703.1 PREDICTED: pentatricopeptide repeat-containing pr... 96 8e-22 XP_006385505.1 hypothetical protein POPTR_0003s061501g, partial ... 94 8e-22 GAU27785.1 hypothetical protein TSUD_113640 [Trifolium subterran... 95 9e-22 XP_017188117.1 PREDICTED: pentatricopeptide repeat-containing pr... 96 1e-21 XP_015870951.1 PREDICTED: pentatricopeptide repeat-containing pr... 96 1e-21 XP_009343702.1 PREDICTED: pentatricopeptide repeat-containing pr... 96 1e-21 XP_019448093.1 PREDICTED: pentatricopeptide repeat-containing pr... 96 1e-21 XP_011040046.1 PREDICTED: pentatricopeptide repeat-containing pr... 96 2e-21 XP_011040044.1 PREDICTED: pentatricopeptide repeat-containing pr... 96 3e-21 >XP_016901584.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80150, mitochondrial [Cucumis melo] Length = 399 Score = 99.8 bits (247), Expect = 6e-23 Identities = 46/59 (77%), Positives = 54/59 (91%) Frame = -3 Query: 179 ALDRIKAERDPHKLFHLFRSNATDRFLFENRFAFDDTVSRLAGAKRFDYIEHLLEHQKT 3 AL ++KAERDP KLFHLF++NA +R + ENRFAF+DTVSRLAGA+RFDYIEHLLEHQKT Sbjct: 40 ALVKLKAERDPEKLFHLFKANAHNRLVIENRFAFEDTVSRLAGARRFDYIEHLLEHQKT 98 >XP_004152207.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80150, mitochondrial [Cucumis sativus] KGN52878.1 hypothetical protein Csa_4G004890 [Cucumis sativus] Length = 399 Score = 99.8 bits (247), Expect = 6e-23 Identities = 46/59 (77%), Positives = 54/59 (91%) Frame = -3 Query: 179 ALDRIKAERDPHKLFHLFRSNATDRFLFENRFAFDDTVSRLAGAKRFDYIEHLLEHQKT 3 AL ++KAERDP KLFHLF++NA +R + ENRFAF+DTVSRLAGA+RFDYIEHLLEHQKT Sbjct: 40 ALVKLKAERDPEKLFHLFKANAHNRLVIENRFAFEDTVSRLAGARRFDYIEHLLEHQKT 98 >XP_004486679.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80150, mitochondrial [Cicer arietinum] XP_004486680.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80150, mitochondrial [Cicer arietinum] Length = 397 Score = 98.6 bits (244), Expect = 2e-22 Identities = 48/59 (81%), Positives = 52/59 (88%) Frame = -3 Query: 179 ALDRIKAERDPHKLFHLFRSNATDRFLFENRFAFDDTVSRLAGAKRFDYIEHLLEHQKT 3 ALDR+K+E DPHKLFHLF+SNAT+ L ENRFAF DTVSRLAGAKRFDYIE LLE QKT Sbjct: 35 ALDRLKSEWDPHKLFHLFKSNATNPILIENRFAFYDTVSRLAGAKRFDYIEQLLEQQKT 93 >XP_019457215.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80150, mitochondrial-like [Lupinus angustifolius] XP_019457216.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80150, mitochondrial-like [Lupinus angustifolius] XP_019457217.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80150, mitochondrial-like [Lupinus angustifolius] XP_019457218.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80150, mitochondrial-like [Lupinus angustifolius] XP_019457219.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80150, mitochondrial-like [Lupinus angustifolius] XP_019457220.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80150, mitochondrial-like [Lupinus angustifolius] XP_019457221.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80150, mitochondrial-like [Lupinus angustifolius] XP_019457222.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80150, mitochondrial-like [Lupinus angustifolius] XP_019457224.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80150, mitochondrial-like [Lupinus angustifolius] OIW03856.1 hypothetical protein TanjilG_30132 [Lupinus angustifolius] Length = 386 Score = 98.2 bits (243), Expect = 2e-22 Identities = 46/59 (77%), Positives = 54/59 (91%) Frame = -3 Query: 179 ALDRIKAERDPHKLFHLFRSNATDRFLFENRFAFDDTVSRLAGAKRFDYIEHLLEHQKT 3 ALD++K+ERDP KLFHLF+ NAT+R L ENRFAF+DTV RLAGAKRFD+IE+LLEHQKT Sbjct: 31 ALDKLKSERDPDKLFHLFKFNATNRLLVENRFAFNDTVCRLAGAKRFDHIENLLEHQKT 89 >XP_007215496.1 hypothetical protein PRUPE_ppa006834mg [Prunus persica] Length = 393 Score = 97.4 bits (241), Expect = 4e-22 Identities = 45/59 (76%), Positives = 53/59 (89%) Frame = -3 Query: 179 ALDRIKAERDPHKLFHLFRSNATDRFLFENRFAFDDTVSRLAGAKRFDYIEHLLEHQKT 3 AL ++KAERDP KLFHLF++NA + + ENRFAF+DTVSRLAGA+RFDYIEHLLEHQKT Sbjct: 34 ALVKLKAERDPEKLFHLFKANAHNTLVIENRFAFEDTVSRLAGARRFDYIEHLLEHQKT 92 >ONI16180.1 hypothetical protein PRUPE_3G083000 [Prunus persica] Length = 399 Score = 97.4 bits (241), Expect = 4e-22 Identities = 45/59 (76%), Positives = 53/59 (89%) Frame = -3 Query: 179 ALDRIKAERDPHKLFHLFRSNATDRFLFENRFAFDDTVSRLAGAKRFDYIEHLLEHQKT 3 AL ++KAERDP KLFHLF++NA + + ENRFAF+DTVSRLAGA+RFDYIEHLLEHQKT Sbjct: 40 ALVKLKAERDPEKLFHLFKANAHNTLVIENRFAFEDTVSRLAGARRFDYIEHLLEHQKT 98 >XP_016652143.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80150, mitochondrial [Prunus mume] Length = 399 Score = 97.4 bits (241), Expect = 4e-22 Identities = 45/59 (76%), Positives = 53/59 (89%) Frame = -3 Query: 179 ALDRIKAERDPHKLFHLFRSNATDRFLFENRFAFDDTVSRLAGAKRFDYIEHLLEHQKT 3 AL ++KAERDP KLFHLF++NA + + ENRFAF+DTVSRLAGA+RFDYIEHLLEHQKT Sbjct: 40 ALVKLKAERDPEKLFHLFKANAHNTLVIENRFAFEDTVSRLAGARRFDYIEHLLEHQKT 98 >XP_010278842.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80150, mitochondrial-like [Nelumbo nucifera] XP_010278844.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80150, mitochondrial-like [Nelumbo nucifera] Length = 400 Score = 97.4 bits (241), Expect = 4e-22 Identities = 46/59 (77%), Positives = 53/59 (89%) Frame = -3 Query: 179 ALDRIKAERDPHKLFHLFRSNATDRFLFENRFAFDDTVSRLAGAKRFDYIEHLLEHQKT 3 AL +IKAERDP KLFHLF++NA +RF+ ENRFAF+DTVSRLAGA+RFDYIE LLEH KT Sbjct: 41 ALVKIKAERDPDKLFHLFKANAHNRFVIENRFAFEDTVSRLAGARRFDYIEELLEHHKT 99 >XP_002517613.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80150, mitochondrial [Ricinus communis] XP_015573828.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80150, mitochondrial [Ricinus communis] EEF44777.1 pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 400 Score = 97.4 bits (241), Expect = 4e-22 Identities = 44/59 (74%), Positives = 54/59 (91%) Frame = -3 Query: 179 ALDRIKAERDPHKLFHLFRSNATDRFLFENRFAFDDTVSRLAGAKRFDYIEHLLEHQKT 3 AL ++KAERDP KLF+LF++NA +R + ENRFAF+DT+SRLAGA+RFDYIEHLLEHQKT Sbjct: 41 ALAKLKAERDPEKLFNLFKANARNRLVIENRFAFEDTISRLAGARRFDYIEHLLEHQKT 99 >OAY52837.1 hypothetical protein MANES_04G115200 [Manihot esculenta] Length = 401 Score = 97.4 bits (241), Expect = 4e-22 Identities = 45/59 (76%), Positives = 54/59 (91%) Frame = -3 Query: 179 ALDRIKAERDPHKLFHLFRSNATDRFLFENRFAFDDTVSRLAGAKRFDYIEHLLEHQKT 3 AL ++KAERDP KLF+LF++NA +R + ENRFAF+DTVSRLAGA+RFDYIEHLLEHQKT Sbjct: 42 ALVKLKAERDPEKLFNLFKANAQNRLVIENRFAFEDTVSRLAGARRFDYIEHLLEHQKT 100 >XP_010097248.1 hypothetical protein L484_025797 [Morus notabilis] EXB67315.1 hypothetical protein L484_025797 [Morus notabilis] Length = 403 Score = 97.4 bits (241), Expect = 4e-22 Identities = 45/59 (76%), Positives = 54/59 (91%) Frame = -3 Query: 179 ALDRIKAERDPHKLFHLFRSNATDRFLFENRFAFDDTVSRLAGAKRFDYIEHLLEHQKT 3 AL ++KAERDP KLFHLF++NA +R + ENRFAF+DTV+RLAGA+RFDYIEHLLEHQKT Sbjct: 44 ALVKLKAERDPDKLFHLFKANAHNRIVVENRFAFEDTVARLAGAQRFDYIEHLLEHQKT 102 >XP_009343703.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80150, mitochondrial-like isoform X2 [Pyrus x bretschneideri] Length = 358 Score = 96.3 bits (238), Expect = 8e-22 Identities = 45/59 (76%), Positives = 53/59 (89%) Frame = -3 Query: 179 ALDRIKAERDPHKLFHLFRSNATDRFLFENRFAFDDTVSRLAGAKRFDYIEHLLEHQKT 3 AL ++KAERDP KLFHLF++NA +R + ENRFAF+DTVSRLAGA RFDYIEHLLEHQK+ Sbjct: 40 ALVKLKAERDPEKLFHLFKANAHNRLVIENRFAFEDTVSRLAGACRFDYIEHLLEHQKS 98 >XP_006385505.1 hypothetical protein POPTR_0003s061501g, partial [Populus trichocarpa] XP_006385506.1 hypothetical protein POPTR_0003s061501g, partial [Populus trichocarpa] ERP63302.1 hypothetical protein POPTR_0003s061501g, partial [Populus trichocarpa] ERP63303.1 hypothetical protein POPTR_0003s061501g, partial [Populus trichocarpa] Length = 252 Score = 94.4 bits (233), Expect = 8e-22 Identities = 44/58 (75%), Positives = 52/58 (89%) Frame = -3 Query: 179 ALDRIKAERDPHKLFHLFRSNATDRFLFENRFAFDDTVSRLAGAKRFDYIEHLLEHQK 6 AL ++KAERDP KLF+LF++NA +R + ENRFAF+DTVSRLAGA RFDYIEHLLEHQK Sbjct: 42 ALVKLKAERDPEKLFNLFKANAENRLVVENRFAFEDTVSRLAGANRFDYIEHLLEHQK 99 >GAU27785.1 hypothetical protein TSUD_113640 [Trifolium subterraneum] Length = 277 Score = 94.7 bits (234), Expect = 9e-22 Identities = 46/58 (79%), Positives = 50/58 (86%) Frame = -3 Query: 176 LDRIKAERDPHKLFHLFRSNATDRFLFENRFAFDDTVSRLAGAKRFDYIEHLLEHQKT 3 L +K+E DPHKLFHLF+SNAT+R L ENRFAF DTVSRLAGAKRFDYIE LLE QKT Sbjct: 34 LQLLKSEWDPHKLFHLFKSNATNRLLIENRFAFYDTVSRLAGAKRFDYIEQLLEQQKT 91 >XP_017188117.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80150, mitochondrial [Malus domestica] XP_017188118.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80150, mitochondrial [Malus domestica] XP_017188119.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80150, mitochondrial [Malus domestica] XP_017188120.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80150, mitochondrial [Malus domestica] Length = 399 Score = 96.3 bits (238), Expect = 1e-21 Identities = 45/59 (76%), Positives = 52/59 (88%) Frame = -3 Query: 179 ALDRIKAERDPHKLFHLFRSNATDRFLFENRFAFDDTVSRLAGAKRFDYIEHLLEHQKT 3 AL ++KAERDP KLFHLF++NA +R + ENRFAFDD VSRLAGA RFDYIEHLLEHQK+ Sbjct: 40 ALVKLKAERDPEKLFHLFKANAHNRLVIENRFAFDDMVSRLAGAHRFDYIEHLLEHQKS 98 >XP_015870951.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80150, mitochondrial [Ziziphus jujuba] Length = 399 Score = 96.3 bits (238), Expect = 1e-21 Identities = 45/59 (76%), Positives = 53/59 (89%) Frame = -3 Query: 179 ALDRIKAERDPHKLFHLFRSNATDRFLFENRFAFDDTVSRLAGAKRFDYIEHLLEHQKT 3 AL ++KAERDP KLF LF++NA +R + ENRFAF+DTVSRLAGA+RFDYIEHLLEHQKT Sbjct: 40 ALLKLKAERDPEKLFQLFKANAHNRIVIENRFAFEDTVSRLAGARRFDYIEHLLEHQKT 98 >XP_009343702.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80150, mitochondrial-like isoform X1 [Pyrus x bretschneideri] Length = 399 Score = 96.3 bits (238), Expect = 1e-21 Identities = 45/59 (76%), Positives = 53/59 (89%) Frame = -3 Query: 179 ALDRIKAERDPHKLFHLFRSNATDRFLFENRFAFDDTVSRLAGAKRFDYIEHLLEHQKT 3 AL ++KAERDP KLFHLF++NA +R + ENRFAF+DTVSRLAGA RFDYIEHLLEHQK+ Sbjct: 40 ALVKLKAERDPEKLFHLFKANAHNRLVIENRFAFEDTVSRLAGACRFDYIEHLLEHQKS 98 >XP_019448093.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80150, mitochondrial-like [Lupinus angustifolius] OIW09072.1 hypothetical protein TanjilG_16299 [Lupinus angustifolius] Length = 387 Score = 95.9 bits (237), Expect = 1e-21 Identities = 45/58 (77%), Positives = 52/58 (89%) Frame = -3 Query: 179 ALDRIKAERDPHKLFHLFRSNATDRFLFENRFAFDDTVSRLAGAKRFDYIEHLLEHQK 6 AL ++K+ERDP KLFHLF+SNAT+R + ENRF FDDTVSRLAGAKRFDYIE+LLE QK Sbjct: 29 ALHQLKSERDPDKLFHLFKSNATNRLIVENRFVFDDTVSRLAGAKRFDYIENLLEQQK 86 >XP_011040046.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80150, mitochondrial-like isoform X2 [Populus euphratica] Length = 401 Score = 95.5 bits (236), Expect = 2e-21 Identities = 45/58 (77%), Positives = 52/58 (89%) Frame = -3 Query: 179 ALDRIKAERDPHKLFHLFRSNATDRFLFENRFAFDDTVSRLAGAKRFDYIEHLLEHQK 6 AL R+KAERDP KLF+LF++NA +R + ENRFAF+DTVSRLAGA RFDYIEHLLEHQK Sbjct: 42 ALVRLKAERDPEKLFNLFKANAENRLVVENRFAFEDTVSRLAGANRFDYIEHLLEHQK 99 >XP_011040044.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80150, mitochondrial-like isoform X1 [Populus euphratica] XP_011040045.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80150, mitochondrial-like isoform X1 [Populus euphratica] Length = 428 Score = 95.5 bits (236), Expect = 3e-21 Identities = 45/58 (77%), Positives = 52/58 (89%) Frame = -3 Query: 179 ALDRIKAERDPHKLFHLFRSNATDRFLFENRFAFDDTVSRLAGAKRFDYIEHLLEHQK 6 AL R+KAERDP KLF+LF++NA +R + ENRFAF+DTVSRLAGA RFDYIEHLLEHQK Sbjct: 42 ALVRLKAERDPEKLFNLFKANAENRLVVENRFAFEDTVSRLAGANRFDYIEHLLEHQK 99