BLASTX nr result
ID: Glycyrrhiza28_contig00032878
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00032878 (212 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH15076.1 hypothetical protein GLYMA_14G0668002, partial [Glyci... 52 2e-06 XP_014622018.1 PREDICTED: AT-hook motif nuclear-localized protei... 52 4e-06 >KRH15076.1 hypothetical protein GLYMA_14G0668002, partial [Glycine max] Length = 175 Score = 52.0 bits (123), Expect = 2e-06 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = +1 Query: 121 RDADDMTPSGGQRPHGRPPGSKNKPKSPVV 210 RD ++ T SGG+RP GRPPGSKNKPK PVV Sbjct: 49 RDGEEQTLSGGRRPRGRPPGSKNKPKPPVV 78 >XP_014622018.1 PREDICTED: AT-hook motif nuclear-localized protein 15-like [Glycine max] Length = 273 Score = 52.0 bits (123), Expect = 4e-06 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = +1 Query: 121 RDADDMTPSGGQRPHGRPPGSKNKPKSPVV 210 RD ++ T SGG+RP GRPPGSKNKPK PVV Sbjct: 49 RDGEEQTLSGGRRPRGRPPGSKNKPKPPVV 78