BLASTX nr result
ID: Glycyrrhiza28_contig00032841
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00032841 (324 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP55508.1 putative WRKY transcription factor 72 [Cajanus cajan] 58 1e-07 >KYP55508.1 putative WRKY transcription factor 72 [Cajanus cajan] Length = 548 Score = 58.2 bits (139), Expect = 1e-07 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = +1 Query: 52 MECALGRSGDGGSGLKKEEKRSEYSIGDCEGRHKQETFIE 171 ME A RSGDGGSGLK EEKRSEYS+GD +G HKQE +E Sbjct: 1 MELASERSGDGGSGLK-EEKRSEYSVGDDDGHHKQEIIVE 39