BLASTX nr result
ID: Glycyrrhiza28_contig00032700
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00032700 (240 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_062653945.1 type IV secretion system protein VirB3 [Rhizobium... 93 9e-23 WP_007823591.1 type IV secretion protein VirB3 [Rhizobium sp. CF... 88 6e-21 SCB49394.1 type IV secretion system protein VirB3 [Rhizobium mil... 88 8e-21 WP_040112763.1 type IV secretion protein VirB3 [Rhizobium etli] ... 86 5e-20 WP_047635194.1 type IV secretion protein VirB3 [Rhizobium tropic... 85 9e-20 WP_064813121.1 MULTISPECIES: type IV secretion system protein Vi... 85 1e-19 WP_004123788.1 T4SS VirB3 [Rhizobium freirei] ENN85546.1 T4SS Vi... 85 1e-19 WP_064245707.1 type IV secretion system protein VirB3 [Rhizobium... 84 2e-19 WP_027686130.1 type IV secretion protein VirB3 [Rhizobium legumi... 84 3e-19 WP_003595198.1 type IV secretion protein VirB3 [Rhizobium legumi... 84 4e-19 WP_014763652.1 type IV secretion protein VirB3 [Sinorhizobium fr... 83 6e-19 WP_014857963.1 MULTISPECIES: type IV secretion protein VirB3 [Si... 83 6e-19 WP_064842577.1 type IV secretion system protein VirB3 [Rhizobium... 83 8e-19 WP_010068249.1 MULTISPECIES: type IV secretion protein VirB3 [Rh... 83 8e-19 WP_069461258.1 type IV secretion system protein VirB3 [Ensifer s... 83 8e-19 SCB45558.1 type IV secretion system protein VirB3 [Rhizobium lus... 82 1e-18 WP_047639517.1 type IV secretion protein VirB3 [Rhizobium tropici] 82 1e-18 WP_040111789.1 type IV secretion protein VirB3 [Rhizobium etli] ... 82 1e-18 WP_037190867.1 type IV secretion protein VirB3 [Rhizobium sp. OK... 82 1e-18 WP_034512548.1 type IV secretion protein VirB3 [Agrobacterium rh... 82 1e-18 >WP_062653945.1 type IV secretion system protein VirB3 [Rhizobium sp. Root651] KRA62195.1 type IV secretion system protein VirB3 [Rhizobium sp. Root651] Length = 112 Score = 92.8 bits (229), Expect = 9e-23 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -2 Query: 239 NMFRILLAWVGTRGRSRNAAYWGGATLSPLKLVRRYDERDLSLA 108 NMFRILLAWVGTRGRSRNAAYWGGATLSPLKLVRRYDERDLSLA Sbjct: 69 NMFRILLAWVGTRGRSRNAAYWGGATLSPLKLVRRYDERDLSLA 112 >WP_007823591.1 type IV secretion protein VirB3 [Rhizobium sp. CF142] EJJ26219.1 type IV secretory pathway, VirB3 component [Rhizobium sp. CF142] Length = 112 Score = 88.2 bits (217), Expect = 6e-21 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = -2 Query: 239 NMFRILLAWVGTRGRSRNAAYWGGATLSPLKLVRRYDERDLSLA 108 NMFRILLAW+ TRGRSRNA+YWGGATLSPLKLVRRYDERDLSLA Sbjct: 69 NMFRILLAWIETRGRSRNASYWGGATLSPLKLVRRYDERDLSLA 112 >SCB49394.1 type IV secretion system protein VirB3 [Rhizobium miluonense] Length = 112 Score = 87.8 bits (216), Expect = 8e-21 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = -2 Query: 239 NMFRILLAWVGTRGRSRNAAYWGGATLSPLKLVRRYDERDLSLA 108 NMFRIL+AWV TRGRSRNA+YWGGATLSPLKLVRRYDERDLSLA Sbjct: 69 NMFRILIAWVETRGRSRNASYWGGATLSPLKLVRRYDERDLSLA 112 >WP_040112763.1 type IV secretion protein VirB3 [Rhizobium etli] AJC83433.1 type IV secretion system protein VirB3 2 (plasmid) [Rhizobium etli bv. phaseoli str. IE4803] Length = 112 Score = 85.9 bits (211), Expect = 5e-20 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = -2 Query: 239 NMFRILLAWVGTRGRSRNAAYWGGATLSPLKLVRRYDERDLSLA 108 NMFRIL+AW+ TRGRSRNA+YWGGATLSPLKLVRRYDERD SLA Sbjct: 69 NMFRILIAWIETRGRSRNASYWGGATLSPLKLVRRYDERDFSLA 112 >WP_047635194.1 type IV secretion protein VirB3 [Rhizobium tropici] OJY70716.1 type IV secretion system protein VirB3 [Rhizobium sp. 60-20] Length = 112 Score = 85.1 bits (209), Expect = 9e-20 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -2 Query: 239 NMFRILLAWVGTRGRSRNAAYWGGATLSPLKLVRRYDERDLSLA 108 NMFRILLAW+ TRGRSRNA+YWGGATLSPLKLVR YDERDLSLA Sbjct: 69 NMFRILLAWIETRGRSRNASYWGGATLSPLKLVRCYDERDLSLA 112 >WP_064813121.1 MULTISPECIES: type IV secretion system protein VirB3 [Rhizobium] ANK95544.1 type IV secretion system protein VirB3 2 (plasmid) [Rhizobium sp. N6212] ANL01596.1 type IV secretion system protein VirB3 2 (plasmid) [Rhizobium sp. N621] ANL07724.1 type IV secretion system protein VirB3 2 (plasmid) [Rhizobium etli] ANL13895.1 type IV secretion system protein VirB3 2 (plasmid) [Rhizobium sp. N1341] ANL25879.1 type IV secretion system protein VirB3 2 (plasmid) [Rhizobium sp. N113] ANM38565.1 type IV secretion system protein VirB3 2 (plasmid) [Rhizobium sp. N871] ANM44720.1 type IV secretion system protein VirB3 2 (plasmid) [Rhizobium sp. N741] Length = 112 Score = 84.7 bits (208), Expect = 1e-19 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = -2 Query: 239 NMFRILLAWVGTRGRSRNAAYWGGATLSPLKLVRRYDERDLSLA 108 N FRILLAW+ TRGRSRNAAYWGGATLSPLKL+RRYDER+LSLA Sbjct: 69 NKFRILLAWIETRGRSRNAAYWGGATLSPLKLIRRYDERNLSLA 112 >WP_004123788.1 T4SS VirB3 [Rhizobium freirei] ENN85546.1 T4SS VirB3 [Rhizobium freirei PRF 81] Length = 112 Score = 84.7 bits (208), Expect = 1e-19 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -2 Query: 239 NMFRILLAWVGTRGRSRNAAYWGGATLSPLKLVRRYDERDLSLA 108 NMFRILLAW+ TRGRSRN YWGGATLSPLKL RRYDERDLSLA Sbjct: 69 NMFRILLAWIETRGRSRNTTYWGGATLSPLKLTRRYDERDLSLA 112 >WP_064245707.1 type IV secretion system protein VirB3 [Rhizobium leguminosarum] OAP96481.1 type IV secretion system protein VirB3 [Rhizobium leguminosarum] Length = 112 Score = 84.3 bits (207), Expect = 2e-19 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -2 Query: 239 NMFRILLAWVGTRGRSRNAAYWGGATLSPLKLVRRYDERDLSLA 108 NMFRIL++W+ TRGRSRN AYWGGATLSPLKL RRYDERDLSLA Sbjct: 69 NMFRILISWIETRGRSRNTAYWGGATLSPLKLTRRYDERDLSLA 112 >WP_027686130.1 type IV secretion protein VirB3 [Rhizobium leguminosarum] Length = 112 Score = 84.0 bits (206), Expect = 3e-19 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = -2 Query: 239 NMFRILLAWVGTRGRSRNAAYWGGATLSPLKLVRRYDERDLSLA 108 NMFRIL++W+ TRGRSRNAAYWGGATLSPL L+RRYDERDLSLA Sbjct: 69 NMFRILISWIETRGRSRNAAYWGGATLSPLILIRRYDERDLSLA 112 >WP_003595198.1 type IV secretion protein VirB3 [Rhizobium leguminosarum] EJB01720.1 type IV secretory pathway, VirB3 component [Rhizobium leguminosarum bv. trifolii WSM597] Length = 112 Score = 83.6 bits (205), Expect = 4e-19 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -2 Query: 239 NMFRILLAWVGTRGRSRNAAYWGGATLSPLKLVRRYDERDLSLA 108 NMFRIL++W+ TRGRSRN AYWGGATLSPL LVRRYDERDLSLA Sbjct: 69 NMFRILISWIETRGRSRNTAYWGGATLSPLTLVRRYDERDLSLA 112 >WP_014763652.1 type IV secretion protein VirB3 [Sinorhizobium fredii] AFL51490.1 type IV secretion system protein VirB3 [Sinorhizobium fredii USDA 257] Length = 113 Score = 83.2 bits (204), Expect = 6e-19 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -2 Query: 239 NMFRILLAWVGTRGRSRNAAYWGGATLSPLKLVRRYDERDLSLA 108 NMFRILLAWV TRGRSRN+AYWGGATL+PLKL R+YDERDL LA Sbjct: 70 NMFRILLAWVETRGRSRNSAYWGGATLAPLKLARKYDERDLGLA 113 >WP_014857963.1 MULTISPECIES: type IV secretion protein VirB3 [Sinorhizobium/Ensifer group] CCE99167.1 hypothetical protein SFHH103_04694 (plasmid) [Sinorhizobium fredii HH103] AFL54884.1 type IV secretion system protein VirB3 (plasmid) [Sinorhizobium fredii USDA 257] CEO91853.1 Type IV secretory pathway, VirB3 (plasmid) [Sinorhizobium fredii HH103] KSV90063.1 type IV secretion protein VirB3 [Sinorhizobium fredii USDA 205] OAP35582.1 type IV secretion system protein VirB3 [Ensifer glycinis] Length = 113 Score = 83.2 bits (204), Expect = 6e-19 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -2 Query: 239 NMFRILLAWVGTRGRSRNAAYWGGATLSPLKLVRRYDERDLSLA 108 NMFRILLAWV TRGRSRN+AYWGGATL+PLKL R+YDERDL LA Sbjct: 70 NMFRILLAWVETRGRSRNSAYWGGATLAPLKLARKYDERDLGLA 113 >WP_064842577.1 type IV secretion system protein VirB3 [Rhizobium sp. N324] ANM13678.1 type IV secretion system protein VirB3 (plasmid) [Rhizobium sp. N324] Length = 112 Score = 82.8 bits (203), Expect = 8e-19 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -2 Query: 239 NMFRILLAWVGTRGRSRNAAYWGGATLSPLKLVRRYDERDLS 114 NMFRIL+AW+ TRGRSRNAAYWGGATLSPL L+RRYDERDLS Sbjct: 69 NMFRILIAWIETRGRSRNAAYWGGATLSPLALIRRYDERDLS 110 >WP_010068249.1 MULTISPECIES: type IV secretion protein VirB3 [Rhizobium] ACE93873.1 transport secretion system IV protein, VirB3 (plasmid) [Rhizobium etli CIAT 652] ANM06933.1 type IV secretion system protein VirB3 1 (plasmid) [Rhizobium phaseoli] OHV22794.1 type IV secretion system protein VirB3 [Rhizobium sp. RSm-3] Length = 112 Score = 82.8 bits (203), Expect = 8e-19 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -2 Query: 239 NMFRILLAWVGTRGRSRNAAYWGGATLSPLKLVRRYDERDLS 114 NMFRIL+AW+ TRGRSRNAAYWGGATLSPL L+RRYDERDLS Sbjct: 69 NMFRILIAWIETRGRSRNAAYWGGATLSPLALIRRYDERDLS 110 >WP_069461258.1 type IV secretion system protein VirB3 [Ensifer sp. YIC4027] ODR88402.1 type IV secretion system protein VirB3 [Ensifer sp. YIC4027] Length = 113 Score = 82.8 bits (203), Expect = 8e-19 Identities = 38/44 (86%), Positives = 40/44 (90%) Frame = -2 Query: 239 NMFRILLAWVGTRGRSRNAAYWGGATLSPLKLVRRYDERDLSLA 108 NMFRILLAWV TRGRSRN+AYWGGATLSPLKL R+YDERDL A Sbjct: 70 NMFRILLAWVETRGRSRNSAYWGGATLSPLKLARKYDERDLGFA 113 >SCB45558.1 type IV secretion system protein VirB3 [Rhizobium lusitanum] Length = 112 Score = 82.4 bits (202), Expect = 1e-18 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -2 Query: 239 NMFRILLAWVGTRGRSRNAAYWGGATLSPLKLVRRYDERDLSLA 108 NMFRILLAW+ TRGRSRN AYWGGA+L+PL+LVRRYDERDL LA Sbjct: 69 NMFRILLAWIETRGRSRNGAYWGGASLTPLRLVRRYDERDLGLA 112 >WP_047639517.1 type IV secretion protein VirB3 [Rhizobium tropici] Length = 112 Score = 82.4 bits (202), Expect = 1e-18 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -2 Query: 239 NMFRILLAWVGTRGRSRNAAYWGGATLSPLKLVRRYDERDLSLA 108 NMFRILLAW+ TRGRSRN AYWGGA+L+PL+LVRRYDERDL LA Sbjct: 69 NMFRILLAWIETRGRSRNGAYWGGASLTPLRLVRRYDERDLGLA 112 >WP_040111789.1 type IV secretion protein VirB3 [Rhizobium etli] AJC82296.1 type IV secretion system protein VirB3 1 (plasmid) [Rhizobium etli bv. phaseoli str. IE4803] Length = 112 Score = 82.4 bits (202), Expect = 1e-18 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = -2 Query: 239 NMFRILLAWVGTRGRSRNAAYWGGATLSPLKLVRRYDERDLS 114 NMFRIL+AW+ TRGRSRN AYWGGATLSPLKL RRYDERDLS Sbjct: 69 NMFRILIAWIETRGRSRNTAYWGGATLSPLKLTRRYDERDLS 110 >WP_037190867.1 type IV secretion protein VirB3 [Rhizobium sp. OK494] Length = 112 Score = 82.4 bits (202), Expect = 1e-18 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -2 Query: 239 NMFRILLAWVGTRGRSRNAAYWGGATLSPLKLVRRYDERDLSLA 108 NMFRILLAW+ TRGRSRN AYWGGA+L+PL+LVRRYDERDL LA Sbjct: 69 NMFRILLAWIETRGRSRNGAYWGGASLTPLRLVRRYDERDLGLA 112 >WP_034512548.1 type IV secretion protein VirB3 [Agrobacterium rhizogenes] Length = 112 Score = 82.4 bits (202), Expect = 1e-18 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -2 Query: 239 NMFRILLAWVGTRGRSRNAAYWGGATLSPLKLVRRYDERDLSLA 108 NMFRILLAW+ TRGRSRN AYWGGA+L+PL+LVRRYDERDL LA Sbjct: 69 NMFRILLAWIETRGRSRNGAYWGGASLTPLRLVRRYDERDLGLA 112