BLASTX nr result
ID: Glycyrrhiza28_contig00032544
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00032544 (267 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_054477270.1 branched-chain amino acid ABC transporter substra... 120 2e-31 WP_076467712.1 branched-chain amino acid ABC transporter substra... 120 6e-31 WP_076414788.1 branched-chain amino acid ABC transporter substra... 120 6e-31 WP_070542817.1 branched-chain amino acid ABC transporter substra... 120 6e-31 WP_063587968.1 branched-chain amino acid ABC transporter substra... 120 6e-31 WP_058665176.1 branched-chain amino acid ABC transporter substra... 120 6e-31 WP_054432862.1 branched-chain amino acid ABC transporter substra... 120 6e-31 WP_054499632.1 branched-chain amino acid ABC transporter substra... 120 6e-31 WP_054507032.1 branched-chain amino acid ABC transporter substra... 120 6e-31 WP_054516692.1 branched-chain amino acid ABC transporter substra... 120 6e-31 WP_054416490.1 branched-chain amino acid ABC transporter substra... 120 6e-31 WP_054501802.1 MULTISPECIES: branched-chain amino acid ABC trans... 120 6e-31 WP_049052843.1 MULTISPECIES: branched-chain amino acid ABC trans... 120 6e-31 WP_047992570.1 branched-chain amino acid ABC transporter substra... 120 6e-31 WP_024067841.1 MULTISPECIES: Leucine-, isoleucine-, valine-, thr... 120 6e-31 WP_025136780.1 branched-chain amino acid ABC transporter substra... 120 6e-31 WP_020925012.1 MULTISPECIES: Leucine-, isoleucine-, valine-, thr... 120 6e-31 WP_006393118.1 MULTISPECIES: branched-chain amino acid ABC trans... 120 6e-31 WP_006388950.1 MULTISPECIES: branched-chain amino acid ABC trans... 120 6e-31 WP_054457402.1 branched-chain amino acid ABC transporter substra... 120 8e-31 >WP_054477270.1 branched-chain amino acid ABC transporter substrate-binding protein, partial [Achromobacter sp.] Length = 330 Score = 120 bits (302), Expect = 2e-31 Identities = 65/88 (73%), Positives = 68/88 (77%) Frame = +3 Query: 3 KGKIYQTHGAATPDFLKLGGKKVEGALLAASLMLVLDETPDSNPSKKVASEYIXXXXXXX 182 KGK YQTHGAA PDFLKLGGKKVEG +LAASLMLVL E PDSNPSKKVAS+YI Sbjct: 237 KGKFYQTHGAALPDFLKLGGKKVEGTVLAASLMLVLPEMPDSNPSKKVASDYI-AAYEKL 295 Query: 183 XXXXXXTFGANVYDAGLLLTQAIPLAAK 266 TFGANVYDAGLLL +AIPLA K Sbjct: 296 NGSKPATFGANVYDAGLLLEKAIPLAEK 323 >WP_076467712.1 branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter xylosoxidans] OMG89561.1 branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter xylosoxidans] Length = 382 Score = 120 bits (302), Expect = 6e-31 Identities = 65/88 (73%), Positives = 68/88 (77%) Frame = +3 Query: 3 KGKIYQTHGAATPDFLKLGGKKVEGALLAASLMLVLDETPDSNPSKKVASEYIXXXXXXX 182 KGK YQTHGAA PDFLKLGGKKVEG +LAASLMLVL E PDSNPSKKVAS+YI Sbjct: 237 KGKFYQTHGAALPDFLKLGGKKVEGTVLAASLMLVLPEMPDSNPSKKVASDYI-AAYEKL 295 Query: 183 XXXXXXTFGANVYDAGLLLTQAIPLAAK 266 TFGANVYDAGLLL +AIPLA K Sbjct: 296 NGSKPATFGANVYDAGLLLEKAIPLAEK 323 >WP_076414788.1 branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter xylosoxidans] OMG80858.1 branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter xylosoxidans] Length = 382 Score = 120 bits (302), Expect = 6e-31 Identities = 65/88 (73%), Positives = 68/88 (77%) Frame = +3 Query: 3 KGKIYQTHGAATPDFLKLGGKKVEGALLAASLMLVLDETPDSNPSKKVASEYIXXXXXXX 182 KGK YQTHGAA PDFLKLGGKKVEG +LAASLMLVL E PDSNPSKKVAS+YI Sbjct: 237 KGKFYQTHGAALPDFLKLGGKKVEGTVLAASLMLVLPEMPDSNPSKKVASDYI-AAYEKL 295 Query: 183 XXXXXXTFGANVYDAGLLLTQAIPLAAK 266 TFGANVYDAGLLL +AIPLA K Sbjct: 296 NGSKPATFGANVYDAGLLLEKAIPLAEK 323 >WP_070542817.1 branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter sp. HMSC15D03] OFU64457.1 branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter sp. HMSC15D03] Length = 382 Score = 120 bits (302), Expect = 6e-31 Identities = 65/88 (73%), Positives = 68/88 (77%) Frame = +3 Query: 3 KGKIYQTHGAATPDFLKLGGKKVEGALLAASLMLVLDETPDSNPSKKVASEYIXXXXXXX 182 KGK YQTHGAA PDFLKLGGKKVEG +LAASLMLVL E PDSNPSKKVAS+YI Sbjct: 237 KGKFYQTHGAALPDFLKLGGKKVEGTVLAASLMLVLPEMPDSNPSKKVASDYI-AAYEKL 295 Query: 183 XXXXXXTFGANVYDAGLLLTQAIPLAAK 266 TFGANVYDAGLLL +AIPLA K Sbjct: 296 NGSKPATFGANVYDAGLLLEKAIPLAEK 323 >WP_063587968.1 branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter ruhlandii] Length = 382 Score = 120 bits (302), Expect = 6e-31 Identities = 65/88 (73%), Positives = 68/88 (77%) Frame = +3 Query: 3 KGKIYQTHGAATPDFLKLGGKKVEGALLAASLMLVLDETPDSNPSKKVASEYIXXXXXXX 182 KGK YQTHGAA PDFLKLGGKKVEG +LAASLMLVL E PDSNPSKKVAS+YI Sbjct: 237 KGKFYQTHGAALPDFLKLGGKKVEGTVLAASLMLVLPEMPDSNPSKKVASDYI-AAYEKL 295 Query: 183 XXXXXXTFGANVYDAGLLLTQAIPLAAK 266 TFGANVYDAGLLL +AIPLA K Sbjct: 296 NGSKPATFGANVYDAGLLLEKAIPLAEK 323 >WP_058665176.1 branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter xylosoxidans] KTL18682.1 branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter xylosoxidans] Length = 382 Score = 120 bits (302), Expect = 6e-31 Identities = 65/88 (73%), Positives = 68/88 (77%) Frame = +3 Query: 3 KGKIYQTHGAATPDFLKLGGKKVEGALLAASLMLVLDETPDSNPSKKVASEYIXXXXXXX 182 KGK YQTHGAA PDFLKLGGKKVEG +LAASLMLVL E PDSNPSKKVAS+YI Sbjct: 237 KGKFYQTHGAALPDFLKLGGKKVEGTVLAASLMLVLPEMPDSNPSKKVASDYI-AAYEKL 295 Query: 183 XXXXXXTFGANVYDAGLLLTQAIPLAAK 266 TFGANVYDAGLLL +AIPLA K Sbjct: 296 NGSKPATFGANVYDAGLLLEKAIPLAEK 323 >WP_054432862.1 branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter sp.] CUJ49699.1 Receptor family ligand binding region [Achromobacter sp. 2789STDY5608628] CUJ55679.1 Receptor family ligand binding region [Achromobacter sp. 2789STDY5608633] CUJ67207.1 Receptor family ligand binding region [Achromobacter sp. 2789STDY5608621] Length = 382 Score = 120 bits (302), Expect = 6e-31 Identities = 65/88 (73%), Positives = 68/88 (77%) Frame = +3 Query: 3 KGKIYQTHGAATPDFLKLGGKKVEGALLAASLMLVLDETPDSNPSKKVASEYIXXXXXXX 182 KGK YQTHGAA PDFLKLGGKKVEG +LAASLMLVL E PDSNPSKKVAS+YI Sbjct: 237 KGKFYQTHGAALPDFLKLGGKKVEGTVLAASLMLVLPEMPDSNPSKKVASDYI-AAYEKL 295 Query: 183 XXXXXXTFGANVYDAGLLLTQAIPLAAK 266 TFGANVYDAGLLL +AIPLA K Sbjct: 296 NGSKPATFGANVYDAGLLLEKAIPLAEK 323 >WP_054499632.1 branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter sp.] CUJ37425.1 Receptor family ligand binding region [Achromobacter sp. 2789STDY5608612] Length = 382 Score = 120 bits (302), Expect = 6e-31 Identities = 65/88 (73%), Positives = 68/88 (77%) Frame = +3 Query: 3 KGKIYQTHGAATPDFLKLGGKKVEGALLAASLMLVLDETPDSNPSKKVASEYIXXXXXXX 182 KGK YQTHGAA PDFLKLGGKKVEG +LAASLMLVL E PDSNPSKKVAS+YI Sbjct: 237 KGKFYQTHGAALPDFLKLGGKKVEGTVLAASLMLVLPEMPDSNPSKKVASDYI-AAYEKL 295 Query: 183 XXXXXXTFGANVYDAGLLLTQAIPLAAK 266 TFGANVYDAGLLL +AIPLA K Sbjct: 296 NGSKPATFGANVYDAGLLLEKAIPLAEK 323 >WP_054507032.1 branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter sp.] CUJ87113.1 Receptor family ligand binding region [Achromobacter sp. 2789STDY5663429] Length = 382 Score = 120 bits (302), Expect = 6e-31 Identities = 65/88 (73%), Positives = 68/88 (77%) Frame = +3 Query: 3 KGKIYQTHGAATPDFLKLGGKKVEGALLAASLMLVLDETPDSNPSKKVASEYIXXXXXXX 182 KGK YQTHGAA PDFLKLGGKKVEG +LAASLMLVL E PDSNPSKKVAS+YI Sbjct: 237 KGKFYQTHGAALPDFLKLGGKKVEGTVLAASLMLVLPEMPDSNPSKKVASDYI-AAYEKL 295 Query: 183 XXXXXXTFGANVYDAGLLLTQAIPLAAK 266 TFGANVYDAGLLL +AIPLA K Sbjct: 296 NGSKPATFGANVYDAGLLLEKAIPLAEK 323 >WP_054516692.1 branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter sp.] CUK13561.1 Receptor family ligand binding region [Achromobacter sp. 2789STDY5663447] CUJ67707.1 Receptor family ligand binding region [Achromobacter sp. 2789STDY5608632] Length = 382 Score = 120 bits (302), Expect = 6e-31 Identities = 65/88 (73%), Positives = 68/88 (77%) Frame = +3 Query: 3 KGKIYQTHGAATPDFLKLGGKKVEGALLAASLMLVLDETPDSNPSKKVASEYIXXXXXXX 182 KGK YQTHGAA PDFLKLGGKKVEG +LAASLMLVL E PDSNPSKKVAS+YI Sbjct: 237 KGKFYQTHGAALPDFLKLGGKKVEGTVLAASLMLVLPEMPDSNPSKKVASDYI-AAYEKL 295 Query: 183 XXXXXXTFGANVYDAGLLLTQAIPLAAK 266 TFGANVYDAGLLL +AIPLA K Sbjct: 296 NGSKPATFGANVYDAGLLLEKAIPLAEK 323 >WP_054416490.1 branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter sp.] CUI52581.1 Receptor family ligand binding region [Achromobacter sp. 2789STDY5608608] CUI63144.1 Receptor family ligand binding region [Achromobacter sp. 2789STDY5608617] CUK06860.1 Receptor family ligand binding region [Achromobacter sp. 2789STDY5608614] AMG43476.1 branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter xylosoxidans] Length = 382 Score = 120 bits (302), Expect = 6e-31 Identities = 65/88 (73%), Positives = 68/88 (77%) Frame = +3 Query: 3 KGKIYQTHGAATPDFLKLGGKKVEGALLAASLMLVLDETPDSNPSKKVASEYIXXXXXXX 182 KGK YQTHGAA PDFLKLGGKKVEG +LAASLMLVL E PDSNPSKKVAS+YI Sbjct: 237 KGKFYQTHGAALPDFLKLGGKKVEGTVLAASLMLVLPEMPDSNPSKKVASDYI-AAYEKL 295 Query: 183 XXXXXXTFGANVYDAGLLLTQAIPLAAK 266 TFGANVYDAGLLL +AIPLA K Sbjct: 296 NGSKPATFGANVYDAGLLLEKAIPLAEK 323 >WP_054501802.1 MULTISPECIES: branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter] CUI91172.1 Receptor family ligand binding region [Achromobacter sp. 2789STDY5608607] OAS93142.1 branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter xylosoxidans] Length = 382 Score = 120 bits (302), Expect = 6e-31 Identities = 65/88 (73%), Positives = 68/88 (77%) Frame = +3 Query: 3 KGKIYQTHGAATPDFLKLGGKKVEGALLAASLMLVLDETPDSNPSKKVASEYIXXXXXXX 182 KGK YQTHGAA PDFLKLGGKKVEG +LAASLMLVL E PDSNPSKKVAS+YI Sbjct: 237 KGKFYQTHGAALPDFLKLGGKKVEGTVLAASLMLVLPEMPDSNPSKKVASDYI-AAYEKL 295 Query: 183 XXXXXXTFGANVYDAGLLLTQAIPLAAK 266 TFGANVYDAGLLL +AIPLA K Sbjct: 296 NGSKPATFGANVYDAGLLLEKAIPLAEK 323 >WP_049052843.1 MULTISPECIES: branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter] KOQ27394.1 branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter xylosoxidans] KOQ29639.1 branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter xylosoxidans] KOQ34475.1 branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter xylosoxidans] KOQ44684.1 branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter xylosoxidans] KOQ49448.1 branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter xylosoxidans] KOQ53358.1 branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter xylosoxidans] KOQ57015.1 branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter xylosoxidans] CUI41783.1 Receptor family ligand binding region [Achromobacter sp. 2789STDY5608611] CUI95223.1 Receptor family ligand binding region [Achromobacter sp. 2789STDY5608618] CUI47103.1 Receptor family ligand binding region [Achromobacter sp. 2789STDY5608630] CUI67031.1 Receptor family ligand binding region [Achromobacter sp. 2789STDY5608629] CUJ03818.1 Receptor family ligand binding region [Achromobacter sp. 2789STDY5663426] CUI32953.1 Receptor family ligand binding region [Achromobacter sp. 2789STDY5608622] CUJ81279.1 Receptor family ligand binding region [Achromobacter sp. 2789STDY5663443] CUJ60351.1 Receptor family ligand binding region [Achromobacter sp. 2789STDY5608620] CUJ14718.1 Receptor family ligand binding region [Achromobacter sp. 2789STDY5608624] KWU18745.1 branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter xylosoxidans] OFO63480.1 branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter sp. HMSC057D05] OFQ52184.1 branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter sp. HMSC056C09] OMG76578.1 branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter xylosoxidans] Length = 382 Score = 120 bits (302), Expect = 6e-31 Identities = 65/88 (73%), Positives = 68/88 (77%) Frame = +3 Query: 3 KGKIYQTHGAATPDFLKLGGKKVEGALLAASLMLVLDETPDSNPSKKVASEYIXXXXXXX 182 KGK YQTHGAA PDFLKLGGKKVEG +LAASLMLVL E PDSNPSKKVAS+YI Sbjct: 237 KGKFYQTHGAALPDFLKLGGKKVEGTVLAASLMLVLPEMPDSNPSKKVASDYI-AAYEKL 295 Query: 183 XXXXXXTFGANVYDAGLLLTQAIPLAAK 266 TFGANVYDAGLLL +AIPLA K Sbjct: 296 NGSKPATFGANVYDAGLLLEKAIPLAEK 323 >WP_047992570.1 branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter xylosoxidans] KMJ89431.1 branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter xylosoxidans] Length = 382 Score = 120 bits (302), Expect = 6e-31 Identities = 65/88 (73%), Positives = 68/88 (77%) Frame = +3 Query: 3 KGKIYQTHGAATPDFLKLGGKKVEGALLAASLMLVLDETPDSNPSKKVASEYIXXXXXXX 182 KGK YQTHGAA PDFLKLGGKKVEG +LAASLMLVL E PDSNPSKKVAS+YI Sbjct: 237 KGKFYQTHGAALPDFLKLGGKKVEGTVLAASLMLVLPEMPDSNPSKKVASDYI-AAYEKL 295 Query: 183 XXXXXXTFGANVYDAGLLLTQAIPLAAK 266 TFGANVYDAGLLL +AIPLA K Sbjct: 296 NGSKPATFGANVYDAGLLLEKAIPLAEK 323 >WP_024067841.1 MULTISPECIES: Leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein [Achromobacter] AHC45447.1 Leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein [Achromobacter xylosoxidans NBRC 15126 = ATCC 27061] CKG91991.1 Receptor family ligand binding region [Achromobacter xylosoxidans] CUI87499.1 Receptor family ligand binding region [Achromobacter sp. 2789STDY5608616] CUJ34180.1 Receptor family ligand binding region [Achromobacter sp. 2789STDY5608606] OFL31886.1 branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter sp. HMSC070F04] OFS57476.1 branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter sp. HMSC18C08] Length = 382 Score = 120 bits (302), Expect = 6e-31 Identities = 65/88 (73%), Positives = 68/88 (77%) Frame = +3 Query: 3 KGKIYQTHGAATPDFLKLGGKKVEGALLAASLMLVLDETPDSNPSKKVASEYIXXXXXXX 182 KGK YQTHGAA PDFLKLGGKKVEG +LAASLMLVL E PDSNPSKKVAS+YI Sbjct: 237 KGKFYQTHGAALPDFLKLGGKKVEGTVLAASLMLVLPEMPDSNPSKKVASDYI-AAYEKL 295 Query: 183 XXXXXXTFGANVYDAGLLLTQAIPLAAK 266 TFGANVYDAGLLL +AIPLA K Sbjct: 296 NGSKPATFGANVYDAGLLLEKAIPLAEK 323 >WP_025136780.1 branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter sp. DH1f] Length = 382 Score = 120 bits (302), Expect = 6e-31 Identities = 65/88 (73%), Positives = 68/88 (77%) Frame = +3 Query: 3 KGKIYQTHGAATPDFLKLGGKKVEGALLAASLMLVLDETPDSNPSKKVASEYIXXXXXXX 182 KGK YQTHGAA PDFLKLGGKKVEG +LAASLMLVL E PDSNPSKKVAS+YI Sbjct: 237 KGKFYQTHGAALPDFLKLGGKKVEGTVLAASLMLVLPEMPDSNPSKKVASDYI-AAYEKL 295 Query: 183 XXXXXXTFGANVYDAGLLLTQAIPLAAK 266 TFGANVYDAGLLL +AIPLA K Sbjct: 296 NGSKPATFGANVYDAGLLLEKAIPLAEK 323 >WP_020925012.1 MULTISPECIES: Leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein [Achromobacter] CCH05153.1 Leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein [Achromobacter xylosoxidans NH44784-1996] CUI57492.1 Receptor family ligand binding region [Achromobacter sp. 2789STDY5608623] CUJ34280.1 Receptor family ligand binding region [Achromobacter sp. 2789STDY5608619] CUJ29169.1 Receptor family ligand binding region [Achromobacter sp. 2789STDY5608609] Length = 382 Score = 120 bits (302), Expect = 6e-31 Identities = 65/88 (73%), Positives = 68/88 (77%) Frame = +3 Query: 3 KGKIYQTHGAATPDFLKLGGKKVEGALLAASLMLVLDETPDSNPSKKVASEYIXXXXXXX 182 KGK YQTHGAA PDFLKLGGKKVEG +LAASLMLVL E PDSNPSKKVAS+YI Sbjct: 237 KGKFYQTHGAALPDFLKLGGKKVEGTVLAASLMLVLPEMPDSNPSKKVASDYI-AAYEKL 295 Query: 183 XXXXXXTFGANVYDAGLLLTQAIPLAAK 266 TFGANVYDAGLLL +AIPLA K Sbjct: 296 NGSKPATFGANVYDAGLLLEKAIPLAEK 323 >WP_006393118.1 MULTISPECIES: branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter] EGP45502.1 receptor family ligand binding region family protein 8 [Achromobacter insuavis AXX-A] AMG36999.1 branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter xylosoxidans] Length = 382 Score = 120 bits (302), Expect = 6e-31 Identities = 65/88 (73%), Positives = 68/88 (77%) Frame = +3 Query: 3 KGKIYQTHGAATPDFLKLGGKKVEGALLAASLMLVLDETPDSNPSKKVASEYIXXXXXXX 182 KGK YQTHGAA PDFLKLGGKKVEG +LAASLMLVL E PDSNPSKKVAS+YI Sbjct: 237 KGKFYQTHGAALPDFLKLGGKKVEGTVLAASLMLVLPEMPDSNPSKKVASDYI-AAYEKL 295 Query: 183 XXXXXXTFGANVYDAGLLLTQAIPLAAK 266 TFGANVYDAGLLL +AIPLA K Sbjct: 296 NGSKPATFGANVYDAGLLLEKAIPLAEK 323 >WP_006388950.1 MULTISPECIES: branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter] EFV82856.1 Leu/Ile/Val-binding protein [Achromobacter xylosoxidans C54] AIR50114.1 branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter xylosoxidans C54] AKP88485.1 Leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein [Achromobacter xylosoxidans] ALX82596.1 branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter denitrificans] OCZ65442.1 branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter xylosoxidans] OCZ80105.1 branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter xylosoxidans] ODA18530.1 branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter xylosoxidans] AOU96027.1 branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter ruhlandii] Length = 382 Score = 120 bits (302), Expect = 6e-31 Identities = 65/88 (73%), Positives = 68/88 (77%) Frame = +3 Query: 3 KGKIYQTHGAATPDFLKLGGKKVEGALLAASLMLVLDETPDSNPSKKVASEYIXXXXXXX 182 KGK YQTHGAA PDFLKLGGKKVEG +LAASLMLVL E PDSNPSKKVAS+YI Sbjct: 237 KGKFYQTHGAALPDFLKLGGKKVEGTVLAASLMLVLPEMPDSNPSKKVASDYI-AAYEKL 295 Query: 183 XXXXXXTFGANVYDAGLLLTQAIPLAAK 266 TFGANVYDAGLLL +AIPLA K Sbjct: 296 NGSKPATFGANVYDAGLLLEKAIPLAEK 323 >WP_054457402.1 branched-chain amino acid ABC transporter substrate-binding protein [Achromobacter sp.] CUJ61016.1 Receptor family ligand binding region [Achromobacter sp. 2789STDY5608625] Length = 383 Score = 120 bits (301), Expect = 8e-31 Identities = 64/88 (72%), Positives = 68/88 (77%) Frame = +3 Query: 3 KGKIYQTHGAATPDFLKLGGKKVEGALLAASLMLVLDETPDSNPSKKVASEYIXXXXXXX 182 KGK YQTHGAA PDFLKLGGKKVEG +LAASLMLVL E PDSNPSKKVAS+YI Sbjct: 238 KGKFYQTHGAALPDFLKLGGKKVEGTVLAASLMLVLPEMPDSNPSKKVASDYI-AAYEKL 296 Query: 183 XXXXXXTFGANVYDAGLLLTQAIPLAAK 266 TFGANVYDAGLLL +A+PLA K Sbjct: 297 NGSKPATFGANVYDAGLLLEKAVPLAEK 324