BLASTX nr result
ID: Glycyrrhiza28_contig00032337
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00032337 (380 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004500422.1 PREDICTED: protein ROOT PRIMORDIUM DEFECTIVE 1 is... 75 3e-13 XP_004500421.1 PREDICTED: protein ROOT PRIMORDIUM DEFECTIVE 1 is... 75 3e-13 GAU18583.1 hypothetical protein TSUD_124140 [Trifolium subterran... 67 1e-10 XP_013460526.1 plant organelle RNA recognition domain protein [M... 64 2e-09 XP_013460525.1 plant organelle RNA recognition domain protein [M... 64 2e-09 >XP_004500422.1 PREDICTED: protein ROOT PRIMORDIUM DEFECTIVE 1 isoform X2 [Cicer arietinum] Length = 398 Score = 74.7 bits (182), Expect = 3e-13 Identities = 38/55 (69%), Positives = 43/55 (78%) Frame = +2 Query: 215 MSNRVWKKMGLLTVMGSHIMNLLSKHKQQHVLCVSVFVRSKTTSSQYVETRARDP 379 MSNRV K LLT MG+HI+N L+KHKQQ CVS +RSKTTS QYVE+RARDP Sbjct: 1 MSNRVCMKKWLLTAMGTHIVNFLTKHKQQQAFCVS--IRSKTTSIQYVESRARDP 53 >XP_004500421.1 PREDICTED: protein ROOT PRIMORDIUM DEFECTIVE 1 isoform X1 [Cicer arietinum] Length = 422 Score = 74.7 bits (182), Expect = 3e-13 Identities = 38/55 (69%), Positives = 43/55 (78%) Frame = +2 Query: 215 MSNRVWKKMGLLTVMGSHIMNLLSKHKQQHVLCVSVFVRSKTTSSQYVETRARDP 379 MSNRV K LLT MG+HI+N L+KHKQQ CVS +RSKTTS QYVE+RARDP Sbjct: 1 MSNRVCMKKWLLTAMGTHIVNFLTKHKQQQAFCVS--IRSKTTSIQYVESRARDP 53 >GAU18583.1 hypothetical protein TSUD_124140 [Trifolium subterraneum] Length = 424 Score = 67.4 bits (163), Expect = 1e-10 Identities = 34/54 (62%), Positives = 42/54 (77%) Frame = +2 Query: 215 MSNRVWKKMGLLTVMGSHIMNLLSKHKQQHVLCVSVFVRSKTTSSQYVETRARD 376 MS RV+ K L++VMG+HI+N L+KHKQQ L VS+ +RSKTTS Q VE RARD Sbjct: 1 MSTRVFMKNRLMSVMGTHILNFLTKHKQQQSLFVSINIRSKTTSVQSVELRARD 54 >XP_013460526.1 plant organelle RNA recognition domain protein [Medicago truncatula] KEH34560.1 plant organelle RNA recognition domain protein [Medicago truncatula] Length = 401 Score = 63.9 bits (154), Expect = 2e-09 Identities = 36/58 (62%), Positives = 43/58 (74%), Gaps = 3/58 (5%) Frame = +2 Query: 215 MSNRVWKKMGLLTVMGSHIMNLLSKHK---QQHVLCVSVFVRSKTTSSQYVETRARDP 379 MS+RV+ K LT MG+HI+N L++HK QQ LCV FVRSKTTS QYV +RARDP Sbjct: 1 MSHRVFMKKRSLTQMGTHIVNFLTQHKHQNQQQPLCV--FVRSKTTSIQYVNSRARDP 56 >XP_013460525.1 plant organelle RNA recognition domain protein [Medicago truncatula] KEH34559.1 plant organelle RNA recognition domain protein [Medicago truncatula] Length = 425 Score = 63.9 bits (154), Expect = 2e-09 Identities = 36/58 (62%), Positives = 43/58 (74%), Gaps = 3/58 (5%) Frame = +2 Query: 215 MSNRVWKKMGLLTVMGSHIMNLLSKHK---QQHVLCVSVFVRSKTTSSQYVETRARDP 379 MS+RV+ K LT MG+HI+N L++HK QQ LCV FVRSKTTS QYV +RARDP Sbjct: 1 MSHRVFMKKRSLTQMGTHIVNFLTQHKHQNQQQPLCV--FVRSKTTSIQYVNSRARDP 56