BLASTX nr result
ID: Glycyrrhiza28_contig00032184
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00032184 (271 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN25611.1 Pentatricopeptide repeat-containing protein, mitochon... 65 2e-10 XP_003538658.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 2e-10 XP_003516732.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 2e-10 BAT78563.1 hypothetical protein VIGAN_02125700, partial [Vigna a... 57 6e-08 XP_007144700.1 hypothetical protein PHAVU_007G177800g [Phaseolus... 57 1e-07 GAU11715.1 hypothetical protein TSUD_74660 [Trifolium subterraneum] 57 2e-07 BAT95547.1 hypothetical protein VIGAN_08229700, partial [Vigna a... 53 3e-07 XP_017430389.1 PREDICTED: pentatricopeptide repeat-containing pr... 54 1e-06 BAT82344.1 hypothetical protein VIGAN_03234600 [Vigna angularis ... 54 1e-06 XP_017414001.1 PREDICTED: pentatricopeptide repeat-containing pr... 53 4e-06 >KHN25611.1 Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 523 Score = 65.1 bits (157), Expect = 2e-10 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +2 Query: 167 MAFQSLFSKHKILTSFSCPLVQHKPNCHHFHSFPT 271 MAFQSLFSK+KIL SF C LVQHKP+ HHFHSFPT Sbjct: 1 MAFQSLFSKYKILPSFFCTLVQHKPSYHHFHSFPT 35 >XP_003538658.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52640, mitochondrial-like [Glycine max] KRH27739.1 hypothetical protein GLYMA_11G011600 [Glycine max] Length = 523 Score = 65.1 bits (157), Expect = 2e-10 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +2 Query: 167 MAFQSLFSKHKILTSFSCPLVQHKPNCHHFHSFPT 271 MAFQSLFSK+KIL SF C LVQHKP+ HHFHSFPT Sbjct: 1 MAFQSLFSKYKILPSFFCTLVQHKPSYHHFHSFPT 35 >XP_003516732.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52640, mitochondrial-like [Glycine max] KRH77700.1 hypothetical protein GLYMA_01G228800 [Glycine max] Length = 523 Score = 65.1 bits (157), Expect = 2e-10 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +2 Query: 167 MAFQSLFSKHKILTSFSCPLVQHKPNCHHFHSFPT 271 MAFQSLFSK+KIL SF C LVQHKP+ HHFHSFPT Sbjct: 1 MAFQSLFSKYKILPSFFCTLVQHKPSYHHFHSFPT 35 >BAT78563.1 hypothetical protein VIGAN_02125700, partial [Vigna angularis var. angularis] Length = 211 Score = 57.4 bits (137), Expect = 6e-08 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +2 Query: 152 ITMSKMAFQSLFSKHKILTSFSCPLVQHKPNCHHFHSFP 268 +T+S MAFQS FSK+K L SF C LVQHKPN +H HSFP Sbjct: 1 MTLSHMAFQSFFSKYKTLPSFFCTLVQHKPN-YHIHSFP 38 >XP_007144700.1 hypothetical protein PHAVU_007G177800g [Phaseolus vulgaris] ESW16694.1 hypothetical protein PHAVU_007G177800g [Phaseolus vulgaris] Length = 524 Score = 57.4 bits (137), Expect = 1e-07 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = +2 Query: 167 MAFQSLFSKHKILTSFSCPLVQHKPNCHHFHSFP 268 MAFQSLFSK+K L SF C LVQHK N HH HSFP Sbjct: 1 MAFQSLFSKYKTLPSFFCTLVQHKVNYHHIHSFP 34 >GAU11715.1 hypothetical protein TSUD_74660 [Trifolium subterraneum] Length = 523 Score = 57.0 bits (136), Expect = 2e-07 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +2 Query: 167 MAFQSLFSKHKILTSFSCPLVQHKPNCHHFHSFPT 271 M+FQS FSKHKIL S+ P+VQHK NCH F+SFPT Sbjct: 1 MSFQSHFSKHKILASYIFPVVQHKFNCHRFYSFPT 35 >BAT95547.1 hypothetical protein VIGAN_08229700, partial [Vigna angularis var. angularis] Length = 85 Score = 53.1 bits (126), Expect = 3e-07 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = +2 Query: 167 MAFQSLFSKHKILTSFSCPLVQHKPNCHHFHSFP 268 MAFQS FSK+K L SF C LVQHKPN +H HSFP Sbjct: 1 MAFQSFFSKYKTLPSFFCTLVQHKPN-YHIHSFP 33 >XP_017430389.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52640, mitochondrial-like [Vigna angularis] XP_017430390.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52640, mitochondrial-like [Vigna angularis] Length = 527 Score = 54.3 bits (129), Expect = 1e-06 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = +2 Query: 152 ITMSKMAFQSLFSKHKILTSFSCPLVQHKPNCHHFHSFP 268 +T+S MAFQS FSK+K L SF C LVQHK N +H HSFP Sbjct: 1 MTLSHMAFQSFFSKYKTLPSFFCTLVQHKSN-YHIHSFP 38 >BAT82344.1 hypothetical protein VIGAN_03234600 [Vigna angularis var. angularis] Length = 527 Score = 54.3 bits (129), Expect = 1e-06 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = +2 Query: 152 ITMSKMAFQSLFSKHKILTSFSCPLVQHKPNCHHFHSFP 268 +T+S MAFQS FSK+K L SF C LVQHK N +H HSFP Sbjct: 1 MTLSHMAFQSFFSKYKTLPSFFCTLVQHKSN-YHIHSFP 38 >XP_017414001.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52640, mitochondrial-like [Vigna angularis] Length = 522 Score = 53.1 bits (126), Expect = 4e-06 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = +2 Query: 167 MAFQSLFSKHKILTSFSCPLVQHKPNCHHFHSFP 268 MAFQS FSK+K L SF C LVQHKPN +H HSFP Sbjct: 1 MAFQSFFSKYKTLPSFFCTLVQHKPN-YHIHSFP 33