BLASTX nr result
ID: Glycyrrhiza28_contig00032166
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00032166 (327 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN26821.1 BTB/POZ domain-containing protein [Glycine soja] 88 3e-20 KRH43782.1 hypothetical protein GLYMA_08G171600 [Glycine max] 86 2e-19 KYP49111.1 hypothetical protein KK1_029143 [Cajanus cajan] 91 4e-19 XP_019443734.1 PREDICTED: BTB/POZ domain-containing protein At1g... 91 4e-19 XP_019443733.1 PREDICTED: BTB/POZ domain-containing protein At1g... 91 4e-19 XP_019443732.1 PREDICTED: BTB/POZ domain-containing protein At1g... 91 4e-19 OIW11671.1 hypothetical protein TanjilG_10817 [Lupinus angustifo... 91 4e-19 XP_019443731.1 PREDICTED: BTB/POZ domain-containing protein At1g... 91 4e-19 XP_017425376.1 PREDICTED: BTB/POZ domain-containing protein At1g... 90 1e-18 KOM42602.1 hypothetical protein LR48_Vigan05g020600 [Vigna angul... 90 1e-18 XP_017425375.1 PREDICTED: BTB/POZ domain-containing protein At1g... 90 1e-18 XP_017425374.1 PREDICTED: BTB/POZ domain-containing protein At1g... 90 1e-18 XP_006598193.1 PREDICTED: BTB/POZ domain-containing protein At1g... 90 1e-18 XP_017425366.1 PREDICTED: BTB/POZ domain-containing protein At1g... 90 1e-18 XP_006598187.1 PREDICTED: BTB/POZ domain-containing protein At1g... 90 1e-18 XP_014501741.1 PREDICTED: BTB/POZ domain-containing protein At1g... 89 3e-18 XP_007149273.1 hypothetical protein PHAVU_005G056400g [Phaseolus... 87 1e-17 XP_014633903.1 PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-co... 86 2e-17 XP_015932267.1 PREDICTED: BTB/POZ domain-containing protein At1g... 86 3e-17 XP_015932266.1 PREDICTED: BTB/POZ domain-containing protein At1g... 86 3e-17 >KHN26821.1 BTB/POZ domain-containing protein [Glycine soja] Length = 128 Score = 88.2 bits (217), Expect = 3e-20 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = +1 Query: 193 HVHTLHRRLLHALNLGSRHFDEKTNRWKWQCANIEVQKNVLRSM 324 H+ TLHRRLLHALNLG+RHFDEKT RWKWQCANIEVQKNVLRS+ Sbjct: 20 HMQTLHRRLLHALNLGTRHFDEKTCRWKWQCANIEVQKNVLRSI 63 >KRH43782.1 hypothetical protein GLYMA_08G171600 [Glycine max] Length = 128 Score = 85.9 bits (211), Expect = 2e-19 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = +1 Query: 193 HVHTLHRRLLHALNLGSRHFDEKTNRWKWQCANIEVQKNVLRSM 324 H+ TLHRRLLHALNLG+RHFDEKT RWKWQCANIEVQ NVLRS+ Sbjct: 20 HMQTLHRRLLHALNLGTRHFDEKTCRWKWQCANIEVQTNVLRSI 63 >KYP49111.1 hypothetical protein KK1_029143 [Cajanus cajan] Length = 739 Score = 90.9 bits (224), Expect = 4e-19 Identities = 39/45 (86%), Positives = 44/45 (97%) Frame = +1 Query: 193 HVHTLHRRLLHALNLGSRHFDEKTNRWKWQCANIEVQKNVLRSMN 327 H+ TLHRRLLHALNLG+RHFDEKTN+WKWQCANIEVQKNVLRS++ Sbjct: 14 HMQTLHRRLLHALNLGTRHFDEKTNKWKWQCANIEVQKNVLRSIS 58 >XP_019443734.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X4 [Lupinus angustifolius] Length = 826 Score = 90.9 bits (224), Expect = 4e-19 Identities = 39/45 (86%), Positives = 42/45 (93%) Frame = +1 Query: 193 HVHTLHRRLLHALNLGSRHFDEKTNRWKWQCANIEVQKNVLRSMN 327 H+ TLH RLLH LNLG+RHFDEKTNRWKWQCANIEVQKNVLRS+N Sbjct: 16 HIQTLHHRLLHELNLGTRHFDEKTNRWKWQCANIEVQKNVLRSIN 60 >XP_019443733.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X3 [Lupinus angustifolius] Length = 842 Score = 90.9 bits (224), Expect = 4e-19 Identities = 39/45 (86%), Positives = 42/45 (93%) Frame = +1 Query: 193 HVHTLHRRLLHALNLGSRHFDEKTNRWKWQCANIEVQKNVLRSMN 327 H+ TLH RLLH LNLG+RHFDEKTNRWKWQCANIEVQKNVLRS+N Sbjct: 16 HIQTLHHRLLHELNLGTRHFDEKTNRWKWQCANIEVQKNVLRSIN 60 >XP_019443732.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X2 [Lupinus angustifolius] Length = 854 Score = 90.9 bits (224), Expect = 4e-19 Identities = 39/45 (86%), Positives = 42/45 (93%) Frame = +1 Query: 193 HVHTLHRRLLHALNLGSRHFDEKTNRWKWQCANIEVQKNVLRSMN 327 H+ TLH RLLH LNLG+RHFDEKTNRWKWQCANIEVQKNVLRS+N Sbjct: 16 HIQTLHHRLLHELNLGTRHFDEKTNRWKWQCANIEVQKNVLRSIN 60 >OIW11671.1 hypothetical protein TanjilG_10817 [Lupinus angustifolius] Length = 938 Score = 90.9 bits (224), Expect = 4e-19 Identities = 39/45 (86%), Positives = 42/45 (93%) Frame = +1 Query: 193 HVHTLHRRLLHALNLGSRHFDEKTNRWKWQCANIEVQKNVLRSMN 327 H+ TLH RLLH LNLG+RHFDEKTNRWKWQCANIEVQKNVLRS+N Sbjct: 16 HIQTLHHRLLHELNLGTRHFDEKTNRWKWQCANIEVQKNVLRSIN 60 >XP_019443731.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Lupinus angustifolius] Length = 1016 Score = 90.9 bits (224), Expect = 4e-19 Identities = 39/45 (86%), Positives = 42/45 (93%) Frame = +1 Query: 193 HVHTLHRRLLHALNLGSRHFDEKTNRWKWQCANIEVQKNVLRSMN 327 H+ TLH RLLH LNLG+RHFDEKTNRWKWQCANIEVQKNVLRS+N Sbjct: 16 HIQTLHHRLLHELNLGTRHFDEKTNRWKWQCANIEVQKNVLRSIN 60 >XP_017425376.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X4 [Vigna angularis] Length = 633 Score = 89.7 bits (221), Expect = 1e-18 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +1 Query: 193 HVHTLHRRLLHALNLGSRHFDEKTNRWKWQCANIEVQKNVLRSM 324 H+ TLHRRL+HALNLG+RHFDEKTNRW+WQCANIEVQKNVLRS+ Sbjct: 18 HMQTLHRRLIHALNLGTRHFDEKTNRWRWQCANIEVQKNVLRSI 61 >KOM42602.1 hypothetical protein LR48_Vigan05g020600 [Vigna angularis] Length = 749 Score = 89.7 bits (221), Expect = 1e-18 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +1 Query: 193 HVHTLHRRLLHALNLGSRHFDEKTNRWKWQCANIEVQKNVLRSM 324 H+ TLHRRL+HALNLG+RHFDEKTNRW+WQCANIEVQKNVLRS+ Sbjct: 18 HMQTLHRRLIHALNLGTRHFDEKTNRWRWQCANIEVQKNVLRSI 61 >XP_017425375.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X3 [Vigna angularis] Length = 875 Score = 89.7 bits (221), Expect = 1e-18 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +1 Query: 193 HVHTLHRRLLHALNLGSRHFDEKTNRWKWQCANIEVQKNVLRSM 324 H+ TLHRRL+HALNLG+RHFDEKTNRW+WQCANIEVQKNVLRS+ Sbjct: 18 HMQTLHRRLIHALNLGTRHFDEKTNRWRWQCANIEVQKNVLRSI 61 >XP_017425374.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X2 [Vigna angularis] Length = 942 Score = 89.7 bits (221), Expect = 1e-18 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +1 Query: 193 HVHTLHRRLLHALNLGSRHFDEKTNRWKWQCANIEVQKNVLRSM 324 H+ TLHRRL+HALNLG+RHFDEKTNRW+WQCANIEVQKNVLRS+ Sbjct: 18 HMQTLHRRLIHALNLGTRHFDEKTNRWRWQCANIEVQKNVLRSI 61 >XP_006598193.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X2 [Glycine max] XP_014623406.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X2 [Glycine max] XP_014623407.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X2 [Glycine max] KRH13662.1 hypothetical protein GLYMA_15G255000 [Glycine max] Length = 1000 Score = 89.7 bits (221), Expect = 1e-18 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = +1 Query: 193 HVHTLHRRLLHALNLGSRHFDEKTNRWKWQCANIEVQKNVLRSM 324 H+ TLHRRLLHALNLG+RHFDEKTNRW WQCANIEVQKNVLRS+ Sbjct: 18 HMQTLHRRLLHALNLGTRHFDEKTNRWNWQCANIEVQKNVLRSI 61 >XP_017425366.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Vigna angularis] XP_017425367.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Vigna angularis] XP_017425368.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Vigna angularis] XP_017425370.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Vigna angularis] XP_017425371.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Vigna angularis] XP_017425372.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Vigna angularis] XP_017425373.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Vigna angularis] BAT93277.1 hypothetical protein VIGAN_07221800 [Vigna angularis var. angularis] Length = 1009 Score = 89.7 bits (221), Expect = 1e-18 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +1 Query: 193 HVHTLHRRLLHALNLGSRHFDEKTNRWKWQCANIEVQKNVLRSM 324 H+ TLHRRL+HALNLG+RHFDEKTNRW+WQCANIEVQKNVLRS+ Sbjct: 18 HMQTLHRRLIHALNLGTRHFDEKTNRWRWQCANIEVQKNVLRSI 61 >XP_006598187.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Glycine max] XP_006598188.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Glycine max] XP_006598190.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Glycine max] XP_006598191.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Glycine max] XP_006598192.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Glycine max] XP_003545911.2 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Glycine max] XP_014623405.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Glycine max] KRH13663.1 hypothetical protein GLYMA_15G255000 [Glycine max] KRH13664.1 hypothetical protein GLYMA_15G255000 [Glycine max] Length = 1020 Score = 89.7 bits (221), Expect = 1e-18 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = +1 Query: 193 HVHTLHRRLLHALNLGSRHFDEKTNRWKWQCANIEVQKNVLRSM 324 H+ TLHRRLLHALNLG+RHFDEKTNRW WQCANIEVQKNVLRS+ Sbjct: 18 HMQTLHRRLLHALNLGTRHFDEKTNRWNWQCANIEVQKNVLRSI 61 >XP_014501741.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Vigna radiata var. radiata] XP_014501742.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Vigna radiata var. radiata] XP_014501743.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Vigna radiata var. radiata] Length = 1009 Score = 88.6 bits (218), Expect = 3e-18 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = +1 Query: 193 HVHTLHRRLLHALNLGSRHFDEKTNRWKWQCANIEVQKNVLRSM 324 H+ LHRRLLHALNLG+RHFDEKTNRW+WQCANIEVQKNVLRS+ Sbjct: 18 HMQNLHRRLLHALNLGTRHFDEKTNRWRWQCANIEVQKNVLRSI 61 >XP_007149273.1 hypothetical protein PHAVU_005G056400g [Phaseolus vulgaris] ESW21267.1 hypothetical protein PHAVU_005G056400g [Phaseolus vulgaris] Length = 1011 Score = 86.7 bits (213), Expect = 1e-17 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = +1 Query: 193 HVHTLHRRLLHALNLGSRHFDEKTNRWKWQCANIEVQKNVLRSM 324 H+ TLHRRLLH LNLG+RHFDEKT RW+WQCANIEVQKNVLRS+ Sbjct: 18 HMQTLHRRLLHTLNLGNRHFDEKTKRWRWQCANIEVQKNVLRSI 61 >XP_014633903.1 PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein At1g04390-like [Glycine max] Length = 549 Score = 85.9 bits (211), Expect = 2e-17 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = +1 Query: 193 HVHTLHRRLLHALNLGSRHFDEKTNRWKWQCANIEVQKNVLRSM 324 H+ TLHRRLLHALNLG+RHFDEKT RWKWQCANIEVQ NVLRS+ Sbjct: 20 HMQTLHRRLLHALNLGTRHFDEKTCRWKWQCANIEVQTNVLRSI 63 >XP_015932267.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X2 [Arachis duranensis] Length = 886 Score = 85.5 bits (210), Expect = 3e-17 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = +1 Query: 196 VHTLHRRLLHALNLGSRHFDEKTNRWKWQCANIEVQKNVLRSMN 327 + TLH+RLLHALNLG+R+FDEKTN WKWQCANIEVQKNVLRS+N Sbjct: 20 IQTLHQRLLHALNLGTRYFDEKTNTWKWQCANIEVQKNVLRSIN 63 >XP_015932266.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Arachis duranensis] Length = 1018 Score = 85.5 bits (210), Expect = 3e-17 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = +1 Query: 196 VHTLHRRLLHALNLGSRHFDEKTNRWKWQCANIEVQKNVLRSMN 327 + TLH+RLLHALNLG+R+FDEKTN WKWQCANIEVQKNVLRS+N Sbjct: 20 IQTLHQRLLHALNLGTRYFDEKTNTWKWQCANIEVQKNVLRSIN 63