BLASTX nr result
ID: Glycyrrhiza28_contig00032137
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00032137 (239 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_024583743.1 MULTISPECIES: hypothetical protein [Bradyrhizobiu... 71 2e-13 WP_076830782.1 hypothetical protein [Bradyrhizobium sp. UFLA 03-... 71 2e-13 SEC89503.1 hypothetical protein SAMN05444164_3032 [Bradyrhizobiu... 71 2e-13 WP_016843676.1 MULTISPECIES: hypothetical protein [Bradyrhizobiu... 71 2e-13 WP_074131900.1 hypothetical protein [Bradyrhizobium sp. NAS96.2]... 70 5e-13 WP_063695545.1 hypothetical protein [Bradyrhizobium embrapense] 70 5e-13 WP_050420523.1 hypothetical protein [Bradyrhizobium viridifuturi] 70 5e-13 WP_029080279.1 hypothetical protein [Bradyrhizobium sp. th.b2] 70 5e-13 ERF81415.1 tartronate-semialdehyde synthase [Bradyrhizobium sp. ... 70 5e-13 SHG12674.1 hypothetical protein SAMN05444169_0676 [Bradyrhizobiu... 70 1e-12 WP_074117173.1 hypothetical protein [Bradyrhizobium sp. AS23.2] ... 69 1e-12 OKO82302.1 hypothetical protein AC629_24300 [Bradyrhizobium sp. ... 69 1e-12 WP_074818884.1 hypothetical protein [Bradyrhizobium lablabi] SDJ... 69 1e-12 WP_061876634.1 hypothetical protein [Bradyrhizobium liaoningense... 69 1e-12 WP_066507655.1 hypothetical protein [Bradyrhizobium sp. BR 10303... 69 1e-12 WP_044539141.1 MULTISPECIES: hypothetical protein [Bradyrhizobiu... 69 1e-12 WP_035679986.1 hypothetical protein [Bradyrhizobium liaoningense] 69 1e-12 WP_028181656.1 hypothetical protein [Bradyrhizobium japonicum] 69 1e-12 WP_028165514.1 hypothetical protein [Bradyrhizobium elkanii] 69 1e-12 WP_028160243.1 hypothetical protein [Bradyrhizobium japonicum] K... 69 1e-12 >WP_024583743.1 MULTISPECIES: hypothetical protein [Bradyrhizobium] KIU49451.1 hypothetical protein QU41_10855 [Bradyrhizobium elkanii] OCX31978.1 hypothetical protein QU42_07020 [Bradyrhizobium sp. UASWS1016] Length = 200 Score = 71.2 bits (173), Expect = 2e-13 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -2 Query: 238 NIVLVPIRSGIGLRLGASVGYLKFTPRATWNPF 140 NIVLVPIRSGIGLRLGASVGYLKFTPRATWNPF Sbjct: 168 NIVLVPIRSGIGLRLGASVGYLKFTPRATWNPF 200 >WP_076830782.1 hypothetical protein [Bradyrhizobium sp. UFLA 03-321] OMI05144.1 hypothetical protein BSN85_25810 [Bradyrhizobium sp. UFLA 03-321] Length = 201 Score = 71.2 bits (173), Expect = 2e-13 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -2 Query: 238 NIVLVPIRSGIGLRLGASVGYLKFTPRATWNPF 140 NIVLVPIRSGIGLRLGASVGYLKFTPRATWNPF Sbjct: 169 NIVLVPIRSGIGLRLGASVGYLKFTPRATWNPF 201 >SEC89503.1 hypothetical protein SAMN05444164_3032 [Bradyrhizobium erythrophlei] Length = 201 Score = 71.2 bits (173), Expect = 2e-13 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -2 Query: 238 NIVLVPIRSGIGLRLGASVGYLKFTPRATWNPF 140 NIVLVPIRSGIGLRLGASVGYLKFTPRATWNPF Sbjct: 169 NIVLVPIRSGIGLRLGASVGYLKFTPRATWNPF 201 >WP_016843676.1 MULTISPECIES: hypothetical protein [Bradyrhizobium] ODM72948.1 hypothetical protein A6X20_37860 [Bradyrhizobium elkanii] ODM77027.1 hypothetical protein A6452_02455 [Bradyrhizobium elkanii] SDF68535.1 hypothetical protein SAMN05216337_10685 [Bradyrhizobium sp. R5] OIM88811.1 hypothetical protein BLN97_43285 [Bradyrhizobium elkanii] Length = 201 Score = 71.2 bits (173), Expect = 2e-13 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -2 Query: 238 NIVLVPIRSGIGLRLGASVGYLKFTPRATWNPF 140 NIVLVPIRSGIGLRLGASVGYLKFTPRATWNPF Sbjct: 169 NIVLVPIRSGIGLRLGASVGYLKFTPRATWNPF 201 >WP_074131900.1 hypothetical protein [Bradyrhizobium sp. NAS96.2] OKO67771.1 hypothetical protein AC628_37950 [Bradyrhizobium sp. NAS96.2] Length = 201 Score = 70.1 bits (170), Expect = 5e-13 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -2 Query: 238 NIVLVPIRSGIGLRLGASVGYLKFTPRATWNPF 140 NIVLVPIRSGIGLRLGASVGYLK+TPRATWNPF Sbjct: 169 NIVLVPIRSGIGLRLGASVGYLKYTPRATWNPF 201 >WP_063695545.1 hypothetical protein [Bradyrhizobium embrapense] Length = 201 Score = 70.1 bits (170), Expect = 5e-13 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -2 Query: 238 NIVLVPIRSGIGLRLGASVGYLKFTPRATWNPF 140 NIVLVPIRSGIGLRLGASVGYLK+TPRATWNPF Sbjct: 169 NIVLVPIRSGIGLRLGASVGYLKYTPRATWNPF 201 >WP_050420523.1 hypothetical protein [Bradyrhizobium viridifuturi] Length = 201 Score = 70.1 bits (170), Expect = 5e-13 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -2 Query: 238 NIVLVPIRSGIGLRLGASVGYLKFTPRATWNPF 140 NIVLVPIRSGIGLRLGASVGYLK+TPRATWNPF Sbjct: 169 NIVLVPIRSGIGLRLGASVGYLKYTPRATWNPF 201 >WP_029080279.1 hypothetical protein [Bradyrhizobium sp. th.b2] Length = 201 Score = 70.1 bits (170), Expect = 5e-13 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -2 Query: 238 NIVLVPIRSGIGLRLGASVGYLKFTPRATWNPF 140 NIVLVPIRSGIGLRLGASVGYLK+TPRATWNPF Sbjct: 169 NIVLVPIRSGIGLRLGASVGYLKYTPRATWNPF 201 >ERF81415.1 tartronate-semialdehyde synthase [Bradyrhizobium sp. DFCI-1] Length = 201 Score = 70.1 bits (170), Expect = 5e-13 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -2 Query: 238 NIVLVPIRSGIGLRLGASVGYLKFTPRATWNPF 140 NIVLVPIRSGIGLRLGASVGYLK+TPRATWNPF Sbjct: 169 NIVLVPIRSGIGLRLGASVGYLKYTPRATWNPF 201 >SHG12674.1 hypothetical protein SAMN05444169_0676 [Bradyrhizobium erythrophlei] Length = 234 Score = 69.7 bits (169), Expect = 1e-12 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 238 NIVLVPIRSGIGLRLGASVGYLKFTPRATWNPF 140 NIVLVPIRSGIGLRLGA++GYLKFTPRATWNPF Sbjct: 202 NIVLVPIRSGIGLRLGANIGYLKFTPRATWNPF 234 >WP_074117173.1 hypothetical protein [Bradyrhizobium sp. AS23.2] OKO86187.1 hypothetical protein AC630_03915 [Bradyrhizobium sp. AS23.2] Length = 201 Score = 68.9 bits (167), Expect = 1e-12 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -2 Query: 238 NIVLVPIRSGIGLRLGASVGYLKFTPRATWNPF 140 NIVLVPIRSG+GLRLGA++GYLKFTPRATWNPF Sbjct: 169 NIVLVPIRSGLGLRLGANIGYLKFTPRATWNPF 201 >OKO82302.1 hypothetical protein AC629_24300 [Bradyrhizobium sp. NAS80.1] Length = 201 Score = 68.9 bits (167), Expect = 1e-12 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -2 Query: 238 NIVLVPIRSGIGLRLGASVGYLKFTPRATWNPF 140 NIVLVPIRSG+GLRLGA++GYLKFTPRATWNPF Sbjct: 169 NIVLVPIRSGLGLRLGANIGYLKFTPRATWNPF 201 >WP_074818884.1 hypothetical protein [Bradyrhizobium lablabi] SDJ23626.1 hypothetical protein SAMN05444163_4913 [Bradyrhizobium ottawaense] SEC78352.1 hypothetical protein SAMN05444171_2250 [Bradyrhizobium lablabi] SHK89966.1 hypothetical protein SAMN05444321_1075 [Bradyrhizobium lablabi] Length = 201 Score = 68.9 bits (167), Expect = 1e-12 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 238 NIVLVPIRSGIGLRLGASVGYLKFTPRATWNPF 140 NIVLVPIRSGIGLRLGA+VGYLK+TPRATWNPF Sbjct: 169 NIVLVPIRSGIGLRLGANVGYLKYTPRATWNPF 201 >WP_061876634.1 hypothetical protein [Bradyrhizobium liaoningense] KYK50370.1 hypothetical protein A1D31_38985 [Bradyrhizobium liaoningense] Length = 201 Score = 68.9 bits (167), Expect = 1e-12 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -2 Query: 238 NIVLVPIRSGIGLRLGASVGYLKFTPRATWNPF 140 NIVLVPIRSG+GLRLGA++GYLKFTPRATWNPF Sbjct: 169 NIVLVPIRSGLGLRLGANIGYLKFTPRATWNPF 201 >WP_066507655.1 hypothetical protein [Bradyrhizobium sp. BR 10303] KWV54617.1 hypothetical protein AS156_06415 [Bradyrhizobium sp. BR 10303] Length = 201 Score = 68.9 bits (167), Expect = 1e-12 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 238 NIVLVPIRSGIGLRLGASVGYLKFTPRATWNPF 140 NIVLVPIRSGIGLRLGA+VGYLK+TPRATWNPF Sbjct: 169 NIVLVPIRSGIGLRLGANVGYLKYTPRATWNPF 201 >WP_044539141.1 MULTISPECIES: hypothetical protein [Bradyrhizobium] KJC45109.1 hypothetical protein UP09_16095 [Bradyrhizobium sp. LTSP885] KJC58625.1 hypothetical protein UP10_22120 [Bradyrhizobium sp. LTSPM299] Length = 201 Score = 68.9 bits (167), Expect = 1e-12 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 238 NIVLVPIRSGIGLRLGASVGYLKFTPRATWNPF 140 NIVLVPIRSGIGLRLGA+VGYLK+TPRATWNPF Sbjct: 169 NIVLVPIRSGIGLRLGANVGYLKYTPRATWNPF 201 >WP_035679986.1 hypothetical protein [Bradyrhizobium liaoningense] Length = 201 Score = 68.9 bits (167), Expect = 1e-12 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -2 Query: 238 NIVLVPIRSGIGLRLGASVGYLKFTPRATWNPF 140 NIVLVPIRSG+GLRLGA++GYLKFTPRATWNPF Sbjct: 169 NIVLVPIRSGLGLRLGANIGYLKFTPRATWNPF 201 >WP_028181656.1 hypothetical protein [Bradyrhizobium japonicum] Length = 201 Score = 68.9 bits (167), Expect = 1e-12 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -2 Query: 238 NIVLVPIRSGIGLRLGASVGYLKFTPRATWNPF 140 NIVLVPIRSG+GLRLGA++GYLKFTPRATWNPF Sbjct: 169 NIVLVPIRSGLGLRLGANIGYLKFTPRATWNPF 201 >WP_028165514.1 hypothetical protein [Bradyrhizobium elkanii] Length = 201 Score = 68.9 bits (167), Expect = 1e-12 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 238 NIVLVPIRSGIGLRLGASVGYLKFTPRATWNPF 140 NIVLVPIRSGIGLRLGA+VGYLK+TPRATWNPF Sbjct: 169 NIVLVPIRSGIGLRLGANVGYLKYTPRATWNPF 201 >WP_028160243.1 hypothetical protein [Bradyrhizobium japonicum] KGT73123.1 hypothetical protein MA20_46305 [Bradyrhizobium japonicum] Length = 201 Score = 68.9 bits (167), Expect = 1e-12 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -2 Query: 238 NIVLVPIRSGIGLRLGASVGYLKFTPRATWNPF 140 NIVLVPIRSG+GLRLGA++GYLKFTPRATWNPF Sbjct: 169 NIVLVPIRSGLGLRLGANIGYLKFTPRATWNPF 201