BLASTX nr result
ID: Glycyrrhiza28_contig00032128
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00032128 (225 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_074129990.1 marine proteobacterial sortase target protein [Br... 154 4e-42 SDC36336.1 Ca-activated chloride channel family protein [Bradyrh... 153 8e-42 WP_038388615.1 marine proteobacterial sortase target protein [Br... 153 8e-42 WP_029080470.1 marine proteobacterial sortase target protein [Br... 153 8e-42 WP_028341510.1 marine proteobacterial sortase target protein [Br... 153 8e-42 WP_057021196.1 marine proteobacterial sortase target protein [Br... 152 2e-41 WP_050401815.1 marine proteobacterial sortase target protein [Br... 152 2e-41 WP_028335278.1 marine proteobacterial sortase target protein [Br... 152 2e-41 WP_024578715.1 MULTISPECIES: marine proteobacterial sortase targ... 152 2e-41 WP_076864607.1 marine proteobacterial sortase target protein [Br... 150 7e-41 WP_050630163.1 marine proteobacterial sortase target protein [Br... 150 7e-41 WP_076834861.1 marine proteobacterial sortase target protein [Br... 150 1e-40 WP_050383977.1 marine proteobacterial sortase target protein [Br... 150 1e-40 ERF82853.1 marine proteobacterial sortase target protein [Bradyr... 149 3e-40 SED77540.1 Ca-activated chloride channel family protein [Bradyrh... 147 9e-40 WP_069279239.1 marine proteobacterial sortase target protein [Br... 142 5e-38 WP_038374772.1 marine proteobacterial sortase target protein [Br... 142 5e-38 WP_018269464.1 marine proteobacterial sortase target protein [Br... 142 5e-38 WP_044590567.1 marine proteobacterial sortase target protein [Br... 142 5e-38 WP_044540857.1 marine proteobacterial sortase target protein [Br... 142 5e-38 >WP_074129990.1 marine proteobacterial sortase target protein [Bradyrhizobium sp. NAS96.2] OKO72003.1 membrane protein [Bradyrhizobium sp. NAS96.2] Length = 757 Score = 154 bits (389), Expect = 4e-42 Identities = 73/74 (98%), Positives = 74/74 (100%) Frame = -2 Query: 224 GPGETVLVQIEYQEPVQQNGNEFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGATSTDP 45 GPGETVLVQIEYQEPVQQNGNEFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGATSTDP Sbjct: 180 GPGETVLVQIEYQEPVQQNGNEFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGATSTDP 239 Query: 44 VPDRDRIASEVLDP 3 VPDRDRI+SEVLDP Sbjct: 240 VPDRDRISSEVLDP 253 >SDC36336.1 Ca-activated chloride channel family protein [Bradyrhizobium sp. R5] Length = 757 Score = 153 bits (387), Expect = 8e-42 Identities = 73/74 (98%), Positives = 73/74 (98%) Frame = -2 Query: 224 GPGETVLVQIEYQEPVQQNGNEFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGATSTDP 45 GPGETVLVQIEYQEPVQQNGNEFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGATSTDP Sbjct: 180 GPGETVLVQIEYQEPVQQNGNEFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGATSTDP 239 Query: 44 VPDRDRIASEVLDP 3 VPDRDRIA EVLDP Sbjct: 240 VPDRDRIAREVLDP 253 >WP_038388615.1 marine proteobacterial sortase target protein [Bradyrhizobium elkanii] Length = 757 Score = 153 bits (387), Expect = 8e-42 Identities = 73/74 (98%), Positives = 74/74 (100%) Frame = -2 Query: 224 GPGETVLVQIEYQEPVQQNGNEFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGATSTDP 45 GPGETVLVQIEYQEPVQQNG+EFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGATSTDP Sbjct: 180 GPGETVLVQIEYQEPVQQNGSEFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGATSTDP 239 Query: 44 VPDRDRIASEVLDP 3 VPDRDRIASEVLDP Sbjct: 240 VPDRDRIASEVLDP 253 >WP_029080470.1 marine proteobacterial sortase target protein [Bradyrhizobium sp. th.b2] Length = 757 Score = 153 bits (387), Expect = 8e-42 Identities = 73/74 (98%), Positives = 73/74 (98%) Frame = -2 Query: 224 GPGETVLVQIEYQEPVQQNGNEFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGATSTDP 45 GPGETVLVQIEYQEPVQQNGNEFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGATSTDP Sbjct: 180 GPGETVLVQIEYQEPVQQNGNEFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGATSTDP 239 Query: 44 VPDRDRIASEVLDP 3 VPDRDRIA EVLDP Sbjct: 240 VPDRDRIAREVLDP 253 >WP_028341510.1 marine proteobacterial sortase target protein [Bradyrhizobium elkanii] Length = 757 Score = 153 bits (387), Expect = 8e-42 Identities = 73/74 (98%), Positives = 74/74 (100%) Frame = -2 Query: 224 GPGETVLVQIEYQEPVQQNGNEFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGATSTDP 45 GPGETVLVQIEYQEPVQQNG+EFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGATSTDP Sbjct: 180 GPGETVLVQIEYQEPVQQNGSEFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGATSTDP 239 Query: 44 VPDRDRIASEVLDP 3 VPDRDRIASEVLDP Sbjct: 240 VPDRDRIASEVLDP 253 >WP_057021196.1 marine proteobacterial sortase target protein [Bradyrhizobium pachyrhizi] KRP85278.1 hypothetical protein AOQ73_39505 [Bradyrhizobium pachyrhizi] Length = 757 Score = 152 bits (384), Expect = 2e-41 Identities = 72/74 (97%), Positives = 74/74 (100%) Frame = -2 Query: 224 GPGETVLVQIEYQEPVQQNGNEFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGATSTDP 45 GPGETVLVQIEYQEPVQQNG+EFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGATSTDP Sbjct: 180 GPGETVLVQIEYQEPVQQNGSEFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGATSTDP 239 Query: 44 VPDRDRIASEVLDP 3 VPDRDRIAS+VLDP Sbjct: 240 VPDRDRIASQVLDP 253 >WP_050401815.1 marine proteobacterial sortase target protein [Bradyrhizobium embrapense] Length = 757 Score = 152 bits (384), Expect = 2e-41 Identities = 72/74 (97%), Positives = 74/74 (100%) Frame = -2 Query: 224 GPGETVLVQIEYQEPVQQNGNEFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGATSTDP 45 GPGETVLVQIEYQEPVQQNGNEFSLRVPMVVGPRYNPRPVVQSVDLRADG+GWGAT+TDP Sbjct: 180 GPGETVLVQIEYQEPVQQNGNEFSLRVPMVVGPRYNPRPVVQSVDLRADGSGWGATTTDP 239 Query: 44 VPDRDRIASEVLDP 3 VPDRDRIASEVLDP Sbjct: 240 VPDRDRIASEVLDP 253 >WP_028335278.1 marine proteobacterial sortase target protein [Bradyrhizobium elkanii] Length = 757 Score = 152 bits (384), Expect = 2e-41 Identities = 72/74 (97%), Positives = 73/74 (98%) Frame = -2 Query: 224 GPGETVLVQIEYQEPVQQNGNEFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGATSTDP 45 GPGETVLVQIEYQEPVQQNGNEFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGAT+TDP Sbjct: 180 GPGETVLVQIEYQEPVQQNGNEFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGATTTDP 239 Query: 44 VPDRDRIASEVLDP 3 VPDRDRIA EVLDP Sbjct: 240 VPDRDRIAREVLDP 253 >WP_024578715.1 MULTISPECIES: marine proteobacterial sortase target protein [Bradyrhizobium] KIU48999.1 membrane protein [Bradyrhizobium elkanii] OCX29424.1 marine proteobacterial sortase target protein [Bradyrhizobium sp. UASWS1016] Length = 757 Score = 152 bits (384), Expect = 2e-41 Identities = 72/74 (97%), Positives = 74/74 (100%) Frame = -2 Query: 224 GPGETVLVQIEYQEPVQQNGNEFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGATSTDP 45 GPGETVLVQIEYQEPVQQNGNEFSLRVPMVVGPRYNPRPVVQSVDLRADG+GWGAT+TDP Sbjct: 180 GPGETVLVQIEYQEPVQQNGNEFSLRVPMVVGPRYNPRPVVQSVDLRADGSGWGATTTDP 239 Query: 44 VPDRDRIASEVLDP 3 VPDRDRIASEVLDP Sbjct: 240 VPDRDRIASEVLDP 253 >WP_076864607.1 marine proteobacterial sortase target protein [Bradyrhizobium sp. SEMIA 6399] Length = 757 Score = 150 bits (380), Expect = 7e-41 Identities = 71/74 (95%), Positives = 73/74 (98%) Frame = -2 Query: 224 GPGETVLVQIEYQEPVQQNGNEFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGATSTDP 45 GPGETVLVQIEYQEPVQQNGNEFSLRVPMVVGPRYNPRPVVQSVDLRADG+GWGAT+TDP Sbjct: 180 GPGETVLVQIEYQEPVQQNGNEFSLRVPMVVGPRYNPRPVVQSVDLRADGSGWGATTTDP 239 Query: 44 VPDRDRIASEVLDP 3 VPDRDRI SEVLDP Sbjct: 240 VPDRDRITSEVLDP 253 >WP_050630163.1 marine proteobacterial sortase target protein [Bradyrhizobium viridifuturi] Length = 757 Score = 150 bits (380), Expect = 7e-41 Identities = 71/74 (95%), Positives = 73/74 (98%) Frame = -2 Query: 224 GPGETVLVQIEYQEPVQQNGNEFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGATSTDP 45 GPGETVLVQIEYQEPVQQNGNEFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGAT+TDP Sbjct: 180 GPGETVLVQIEYQEPVQQNGNEFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGATTTDP 239 Query: 44 VPDRDRIASEVLDP 3 VPDR+RI SEVLDP Sbjct: 240 VPDRNRITSEVLDP 253 >WP_076834861.1 marine proteobacterial sortase target protein [Bradyrhizobium sp. UFLA 03-321] OMH98470.1 marine proteobacterial sortase target protein [Bradyrhizobium sp. UFLA 03-321] Length = 755 Score = 150 bits (379), Expect = 1e-40 Identities = 71/74 (95%), Positives = 73/74 (98%) Frame = -2 Query: 224 GPGETVLVQIEYQEPVQQNGNEFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGATSTDP 45 GPGETVLVQIEYQEPVQQNG+EFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGATSTDP Sbjct: 180 GPGETVLVQIEYQEPVQQNGSEFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGATSTDP 239 Query: 44 VPDRDRIASEVLDP 3 VPDRDRI+ EVLDP Sbjct: 240 VPDRDRISPEVLDP 253 >WP_050383977.1 marine proteobacterial sortase target protein [Bradyrhizobium pachyrhizi] Length = 757 Score = 150 bits (379), Expect = 1e-40 Identities = 71/74 (95%), Positives = 73/74 (98%) Frame = -2 Query: 224 GPGETVLVQIEYQEPVQQNGNEFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGATSTDP 45 GPGETVLVQIEYQEPVQQNG+EFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGAT+TDP Sbjct: 180 GPGETVLVQIEYQEPVQQNGSEFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGATTTDP 239 Query: 44 VPDRDRIASEVLDP 3 VPDRDRIA EVLDP Sbjct: 240 VPDRDRIAREVLDP 253 >ERF82853.1 marine proteobacterial sortase target protein [Bradyrhizobium sp. DFCI-1] Length = 757 Score = 149 bits (375), Expect = 3e-40 Identities = 70/74 (94%), Positives = 72/74 (97%) Frame = -2 Query: 224 GPGETVLVQIEYQEPVQQNGNEFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGATSTDP 45 GPGETVLVQIEYQEPV+QNGNEFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGAT+TDP Sbjct: 180 GPGETVLVQIEYQEPVRQNGNEFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGATTTDP 239 Query: 44 VPDRDRIASEVLDP 3 VPDRDRI S VLDP Sbjct: 240 VPDRDRITSPVLDP 253 >SED77540.1 Ca-activated chloride channel family protein [Bradyrhizobium erythrophlei] Length = 759 Score = 147 bits (372), Expect = 9e-40 Identities = 70/74 (94%), Positives = 71/74 (95%) Frame = -2 Query: 224 GPGETVLVQIEYQEPVQQNGNEFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGATSTDP 45 GPGETVLVQIEYQEP QQNGNEFSLRVPMVVGPRYNPRPVVQSVDLRADG+GWGA S DP Sbjct: 180 GPGETVLVQIEYQEPAQQNGNEFSLRVPMVVGPRYNPRPVVQSVDLRADGSGWGAASIDP 239 Query: 44 VPDRDRIASEVLDP 3 VPDRDRIASEVLDP Sbjct: 240 VPDRDRIASEVLDP 253 >WP_069279239.1 marine proteobacterial sortase target protein [Bradyrhizobium elkanii] ODM73373.1 marine proteobacterial sortase target protein [Bradyrhizobium elkanii] ODM74014.1 marine proteobacterial sortase target protein [Bradyrhizobium elkanii] Length = 755 Score = 142 bits (359), Expect = 5e-38 Identities = 69/74 (93%), Positives = 72/74 (97%) Frame = -2 Query: 224 GPGETVLVQIEYQEPVQQNGNEFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGATSTDP 45 GPGETVLVQIEYQEPVQQNG+EFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWG +TDP Sbjct: 180 GPGETVLVQIEYQEPVQQNGSEFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWG--TTDP 237 Query: 44 VPDRDRIASEVLDP 3 VPDRDRI+SEVLDP Sbjct: 238 VPDRDRISSEVLDP 251 >WP_038374772.1 marine proteobacterial sortase target protein [Bradyrhizobium elkanii] Length = 755 Score = 142 bits (359), Expect = 5e-38 Identities = 69/74 (93%), Positives = 72/74 (97%) Frame = -2 Query: 224 GPGETVLVQIEYQEPVQQNGNEFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGATSTDP 45 GPGETVLVQIEYQEPVQQNG+EFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWG +TDP Sbjct: 180 GPGETVLVQIEYQEPVQQNGSEFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWG--TTDP 237 Query: 44 VPDRDRIASEVLDP 3 VPDRDRI+SEVLDP Sbjct: 238 VPDRDRISSEVLDP 251 >WP_018269464.1 marine proteobacterial sortase target protein [Bradyrhizobium elkanii] OIM88924.1 marine proteobacterial sortase target protein [Bradyrhizobium elkanii] Length = 755 Score = 142 bits (359), Expect = 5e-38 Identities = 69/74 (93%), Positives = 72/74 (97%) Frame = -2 Query: 224 GPGETVLVQIEYQEPVQQNGNEFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGATSTDP 45 GPGETVLVQIEYQEPVQQNG+EFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWG +TDP Sbjct: 180 GPGETVLVQIEYQEPVQQNGSEFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWG--TTDP 237 Query: 44 VPDRDRIASEVLDP 3 VPDRDRI+SEVLDP Sbjct: 238 VPDRDRISSEVLDP 251 >WP_044590567.1 marine proteobacterial sortase target protein [Bradyrhizobium sp. LTSPM299] KJC57420.1 membrane protein [Bradyrhizobium sp. LTSPM299] Length = 756 Score = 142 bits (359), Expect = 5e-38 Identities = 67/74 (90%), Positives = 70/74 (94%) Frame = -2 Query: 224 GPGETVLVQIEYQEPVQQNGNEFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGATSTDP 45 GPGETVLVQIEYQEPVQQNGN FSLRVPMVVGPRYNP+PVVQSVDLRADG GWGAT+TDP Sbjct: 180 GPGETVLVQIEYQEPVQQNGNAFSLRVPMVVGPRYNPQPVVQSVDLRADGGGWGATTTDP 239 Query: 44 VPDRDRIASEVLDP 3 VPDRDRI+ VLDP Sbjct: 240 VPDRDRISPPVLDP 253 >WP_044540857.1 marine proteobacterial sortase target protein [Bradyrhizobium sp. LTSP885] KJC39051.1 membrane protein [Bradyrhizobium sp. LTSP885] Length = 756 Score = 142 bits (359), Expect = 5e-38 Identities = 67/74 (90%), Positives = 70/74 (94%) Frame = -2 Query: 224 GPGETVLVQIEYQEPVQQNGNEFSLRVPMVVGPRYNPRPVVQSVDLRADGNGWGATSTDP 45 GPGETVLVQIEYQEPVQQNGN FSLRVPMVVGPRYNP+PVVQSVDLRADG GWGAT+TDP Sbjct: 180 GPGETVLVQIEYQEPVQQNGNAFSLRVPMVVGPRYNPQPVVQSVDLRADGGGWGATTTDP 239 Query: 44 VPDRDRIASEVLDP 3 VPDRDRI+ VLDP Sbjct: 240 VPDRDRISPPVLDP 253