BLASTX nr result
ID: Glycyrrhiza28_contig00031915
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00031915 (272 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007145667.1 hypothetical protein PHAVU_007G258200g [Phaseolus... 62 4e-10 KOM34119.1 hypothetical protein LR48_Vigan02g026900 [Vigna angul... 59 5e-09 XP_013467648.1 hypothetical protein MTR_1g053705 [Medicago trunc... 54 6e-07 GAU45765.1 hypothetical protein TSUD_24290 [Trifolium subterraneum] 52 3e-06 >XP_007145667.1 hypothetical protein PHAVU_007G258200g [Phaseolus vulgaris] ESW17661.1 hypothetical protein PHAVU_007G258200g [Phaseolus vulgaris] Length = 132 Score = 61.6 bits (148), Expect = 4e-10 Identities = 34/76 (44%), Positives = 45/76 (59%), Gaps = 1/76 (1%) Frame = -2 Query: 226 MGNENSAQHSKAQDGYAAKVVTSTEPKHV-PKQRMPTRKAEKVGVGVYPTEQHGNKPLDN 50 MGN+NSA D A +P++V +QR + K+E V V YPTE+ G KPL + Sbjct: 1 MGNKNSATSRARSDKRAKLGSIEPQPRNVVSRQRQLSTKSEVVNVRAYPTEKQGEKPLCD 60 Query: 49 DDTFANYIQRAKNKMR 2 D TF+NYIQR K+R Sbjct: 61 DHTFSNYIQRTNYKIR 76 >KOM34119.1 hypothetical protein LR48_Vigan02g026900 [Vigna angularis] Length = 138 Score = 58.9 bits (141), Expect = 5e-09 Identities = 37/79 (46%), Positives = 49/79 (62%), Gaps = 4/79 (5%) Frame = -2 Query: 226 MGNENSAQHSKAQDGYAAKVVTSTEPKH---VPKQRMPTRKAEKVGVGVYPTEQHGN-KP 59 MGN+NSA SKA +G AK+ + EP+ V Q + E V V YPTE+ G+ KP Sbjct: 1 MGNKNSAA-SKALNGQRAKIASFEEPQPQYVVSMQMKHSTNPEVVSVRAYPTEEQGDEKP 59 Query: 58 LDNDDTFANYIQRAKNKMR 2 L +D TF++YIQR K K+R Sbjct: 60 LCDDHTFSDYIQRTKYKIR 78 >XP_013467648.1 hypothetical protein MTR_1g053705 [Medicago truncatula] KEH41685.1 hypothetical protein MTR_1g053705 [Medicago truncatula] Length = 139 Score = 53.5 bits (127), Expect = 6e-07 Identities = 36/80 (45%), Positives = 46/80 (57%), Gaps = 5/80 (6%) Frame = -2 Query: 226 MGNENSAQHSKAQDGYAAKVVTSTEPKHV---PKQRMPTRKAEKVGVGVYPTEQHG--NK 62 MGN++SA +S +D A S EPK+V P QR + K EK+ EQH N Sbjct: 1 MGNQSSA-YSNTEDDEKASNAISNEPKYVDYAPIQRKHSTKVEKL-------EQHAYSNN 52 Query: 61 PLDNDDTFANYIQRAKNKMR 2 P ND+TF N+IQRAK K+R Sbjct: 53 PQVNDETFTNFIQRAKYKIR 72 >GAU45765.1 hypothetical protein TSUD_24290 [Trifolium subterraneum] Length = 148 Score = 52.0 bits (123), Expect = 3e-06 Identities = 35/80 (43%), Positives = 44/80 (55%), Gaps = 5/80 (6%) Frame = -2 Query: 226 MGNENSAQHSKAQDGYAAKVVTSTEPKHVPKQRMPTRKAEK-VGVGVYPTE--QHGNKPL 56 MGN+NS+ +S V + + + P QR T K EK VG GVY E QHGNK Sbjct: 1 MGNQNSSPYSNDSSTEPQYVDYAPKAEKFPIQRKHTTKPEKVVGHGVYTDEEQQHGNKQS 60 Query: 55 D--NDDTFANYIQRAKNKMR 2 ND+ F +IQRAK K+R Sbjct: 61 QAINDEAFTKFIQRAKYKIR 80