BLASTX nr result
ID: Glycyrrhiza28_contig00031882
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00031882 (313 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CEG10289.1 Mn2+ and Fe2+ transporters of the NRAMP family protei... 74 2e-13 EKE17646.1 hypothetical protein ACD_10C00340G0004 [uncultured ba... 74 3e-13 WP_006022591.1 MULTISPECIES: NRAMP family metal ion transporter ... 74 4e-13 >CEG10289.1 Mn2+ and Fe2+ transporters of the NRAMP family protein [Afipia felis] Length = 301 Score = 73.6 bits (179), Expect = 2e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +1 Query: 1 IGFKVFVAATGVEVSIPQIGGTPTSNDAATSNTGSK 108 IGFKVFVAATGVEVSIPQIGGTPTSNDAATSNTGSK Sbjct: 266 IGFKVFVAATGVEVSIPQIGGTPTSNDAATSNTGSK 301 >EKE17646.1 hypothetical protein ACD_10C00340G0004 [uncultured bacterium] Length = 355 Score = 73.6 bits (179), Expect = 3e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +1 Query: 1 IGFKVFVAATGVEVSIPQIGGTPTSNDAATSNTGSK 108 IGFKVFVAATGVEVSIPQIGGTPTSNDAATSNTGSK Sbjct: 320 IGFKVFVAATGVEVSIPQIGGTPTSNDAATSNTGSK 355 >WP_006022591.1 MULTISPECIES: NRAMP family metal ion transporter [Alphaproteobacteria] EKS37461.1 metal ion (Mn2+/Fe2+) transporter (Nramp) family metal ion transporter [Afipia broomeae ATCC 49717] AKR57838.1 Manganese transport protein MntH [Devosia sp. H5989] KQT28387.1 manganese transporter [Bradyrhizobium sp. Leaf396] OCX32018.1 manganese transporter [Bradyrhizobium sp. UASWS1016] Length = 588 Score = 73.6 bits (179), Expect = 4e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +1 Query: 1 IGFKVFVAATGVEVSIPQIGGTPTSNDAATSNTGSK 108 IGFKVFVAATGVEVSIPQIGGTPTSNDAATSNTGSK Sbjct: 553 IGFKVFVAATGVEVSIPQIGGTPTSNDAATSNTGSK 588