BLASTX nr result
ID: Glycyrrhiza28_contig00031878
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00031878 (481 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAV58277.1 hypothetical protein CFOL_v3_01811 [Cephalotus follic... 62 2e-09 >GAV58277.1 hypothetical protein CFOL_v3_01811 [Cephalotus follicularis] Length = 102 Score = 61.6 bits (148), Expect = 2e-09 Identities = 29/50 (58%), Positives = 31/50 (62%), Gaps = 1/50 (2%) Frame = +1 Query: 1 SCYHLLCRHHRCREWGEEGMPLPHQHHLWVEWGCHQCLLLACLQWA-TDL 147 SC L C HH+CREW E + H HH WV W C QC L AC QWA TDL Sbjct: 3 SCCLLHCLHHQCREWVEVSL---HNHHQWVGWECLQCQLSACHQWAPTDL 49