BLASTX nr result
ID: Glycyrrhiza28_contig00031738
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00031738 (486 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_014512136.1 PREDICTED: TBC1 domain family member 15 [Vigna ra... 55 7e-06 XP_004495284.2 PREDICTED: TBC1 domain family member 15-like [Cic... 55 7e-06 XP_007144871.1 hypothetical protein PHAVU_007G191100g [Phaseolus... 55 9e-06 >XP_014512136.1 PREDICTED: TBC1 domain family member 15 [Vigna radiata var. radiata] Length = 421 Score = 55.1 bits (131), Expect = 7e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +1 Query: 373 MICCGEGLCRVLMKSSGTTELDAFYPIRPECVND 474 MI CG GLC VLMKSSGTTEL++FYPIRPEC D Sbjct: 1 MIGCG-GLCGVLMKSSGTTELNSFYPIRPECQAD 33 >XP_004495284.2 PREDICTED: TBC1 domain family member 15-like [Cicer arietinum] Length = 424 Score = 55.1 bits (131), Expect = 7e-06 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = +1 Query: 373 MICCGEGLCRVLMKSSGTTELDAFYPIRPECVNDAST 483 MI CG GL RVLMKSSGTTEL++FYPIRPEC D T Sbjct: 1 MIGCG-GLWRVLMKSSGTTELNSFYPIRPECQADVPT 36 >XP_007144871.1 hypothetical protein PHAVU_007G191100g [Phaseolus vulgaris] XP_007144872.1 hypothetical protein PHAVU_007G191100g [Phaseolus vulgaris] ESW16865.1 hypothetical protein PHAVU_007G191100g [Phaseolus vulgaris] ESW16866.1 hypothetical protein PHAVU_007G191100g [Phaseolus vulgaris] Length = 435 Score = 54.7 bits (130), Expect = 9e-06 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = +1 Query: 373 MICCGEGLCRVLMKSSGTTELDAFYPIRPECVND 474 MI CG GLCR LMKSSGTTEL+AFYPIR EC D Sbjct: 1 MIGCG-GLCRFLMKSSGTTELNAFYPIRAECQGD 33