BLASTX nr result
ID: Glycyrrhiza28_contig00031599
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00031599 (251 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003544128.1 PREDICTED: cyclic nucleotide-gated ion channel 1-... 55 6e-07 XP_012570624.1 PREDICTED: uncharacterized protein LOC105851989 [... 54 2e-06 >XP_003544128.1 PREDICTED: cyclic nucleotide-gated ion channel 1-like [Glycine max] KRH16550.1 hypothetical protein GLYMA_14G161600 [Glycine max] KRH16551.1 hypothetical protein GLYMA_14G161600 [Glycine max] Length = 718 Score = 55.1 bits (131), Expect = 6e-07 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 97 MSTTQQEKFVRFRDWNSEKVSERNYTAIKIT 5 MSTT QEKFVRF+DWNSEK SE NY AIKIT Sbjct: 1 MSTTPQEKFVRFQDWNSEKGSESNYPAIKIT 31 >XP_012570624.1 PREDICTED: uncharacterized protein LOC105851989 [Cicer arietinum] Length = 274 Score = 53.5 bits (127), Expect = 2e-06 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -2 Query: 106 AAVMSTTQQEKFVRFRDWNSEKVSERNYTAIKIT 5 AAVM TTQQEKFVRFRD N EKVSER Y A K T Sbjct: 237 AAVMGTTQQEKFVRFRDSNLEKVSERKYPAFKTT 270