BLASTX nr result
ID: Glycyrrhiza28_contig00031496
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00031496 (231 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU23959.1 hypothetical protein TSUD_183570 [Trifolium subterran... 157 4e-46 XP_014626564.1 PREDICTED: spermidine synthase 2 isoform X2 [Glyc... 155 6e-46 XP_012855259.1 PREDICTED: spermidine synthase-like [Erythranthe ... 156 1e-45 AAV80841.1 spermidine synthase, partial [Phaseolus vulgaris] 154 1e-45 KJB31271.1 hypothetical protein B456_005G183500 [Gossypium raimo... 154 2e-45 GAU23958.1 hypothetical protein TSUD_183580 [Trifolium subterran... 157 2e-45 ABF66657.1 spermidine synthase [Ammopiptanthus mongolicus] 156 3e-45 BAT74662.1 hypothetical protein VIGAN_01237500 [Vigna angularis ... 156 3e-45 XP_014523562.1 PREDICTED: spermidine synthase 2 [Vigna radiata v... 156 3e-45 XP_017408713.1 PREDICTED: spermidine synthase 2 [Vigna angularis... 156 3e-45 XP_012844818.1 PREDICTED: spermidine synthase 2 [Erythranthe gut... 155 3e-45 EPS71978.1 spermidine synthase 1, partial [Genlisea aurea] 155 4e-45 XP_003552013.1 PREDICTED: spermidine synthase 2 isoform X1 [Glyc... 155 4e-45 ABZ01548.1 spermidine synthase X, partial [Silene latifolia] ABZ... 153 5e-45 ABZ01528.1 spermidine synthase X, partial [Silene latifolia] 153 5e-45 ABZ01527.1 spermidine synthase X, partial [Silene latifolia] 153 5e-45 ABZ01524.1 spermidine synthase X, partial [Silene latifolia] ABZ... 153 5e-45 ABZ01566.1 spermidine synthase X, partial [Silene vulgaris] 153 5e-45 ACB86617.1 putative spermidine synthase, partial [Silene dioica] 153 5e-45 ACB86613.1 putative spermidine synthase, partial [Silene conica]... 153 5e-45 >GAU23959.1 hypothetical protein TSUD_183570 [Trifolium subterraneum] Length = 282 Score = 157 bits (396), Expect = 4e-46 Identities = 73/76 (96%), Positives = 76/76 (100%) Frame = -3 Query: 229 VIVDSSDPIGPAQELFEKPFFESVAKALRPGGVLCTQAESIWLHMDIIEDIVSNCRQIFK 50 VIVDSSDPIGPAQELFEKPFF+SVA+ALRPGGV+CTQAESIWLHMDIIEDIVSNCRQIFK Sbjct: 120 VIVDSSDPIGPAQELFEKPFFQSVARALRPGGVMCTQAESIWLHMDIIEDIVSNCRQIFK 179 Query: 49 GSVNYAWTTVPTYPSG 2 GSVNYAWTTVPTYPSG Sbjct: 180 GSVNYAWTTVPTYPSG 195 >XP_014626564.1 PREDICTED: spermidine synthase 2 isoform X2 [Glycine max] Length = 257 Score = 155 bits (393), Expect = 6e-46 Identities = 73/76 (96%), Positives = 75/76 (98%) Frame = -3 Query: 229 VIVDSSDPIGPAQELFEKPFFESVAKALRPGGVLCTQAESIWLHMDIIEDIVSNCRQIFK 50 VIVDSSDPIGPAQELFEKPFF SVAKALRPGGV+CTQAESIWLHMDIIEDIV+NCRQIFK Sbjct: 120 VIVDSSDPIGPAQELFEKPFFSSVAKALRPGGVVCTQAESIWLHMDIIEDIVANCRQIFK 179 Query: 49 GSVNYAWTTVPTYPSG 2 GSVNYAWTTVPTYPSG Sbjct: 180 GSVNYAWTTVPTYPSG 195 >XP_012855259.1 PREDICTED: spermidine synthase-like [Erythranthe guttata] EYU22481.1 hypothetical protein MIMGU_mgv1a010375mg [Erythranthe guttata] Length = 314 Score = 156 bits (395), Expect = 1e-45 Identities = 74/76 (97%), Positives = 75/76 (98%) Frame = -3 Query: 229 VIVDSSDPIGPAQELFEKPFFESVAKALRPGGVLCTQAESIWLHMDIIEDIVSNCRQIFK 50 VIVDSSDPIGPAQELFEKPFFESVAKALRPGGV+CTQAESIWLHM IIEDIVSNCRQIFK Sbjct: 177 VIVDSSDPIGPAQELFEKPFFESVAKALRPGGVMCTQAESIWLHMHIIEDIVSNCRQIFK 236 Query: 49 GSVNYAWTTVPTYPSG 2 GSVNYAWTTVPTYPSG Sbjct: 237 GSVNYAWTTVPTYPSG 252 >AAV80841.1 spermidine synthase, partial [Phaseolus vulgaris] Length = 238 Score = 154 bits (389), Expect = 1e-45 Identities = 73/76 (96%), Positives = 74/76 (97%) Frame = -3 Query: 229 VIVDSSDPIGPAQELFEKPFFESVAKALRPGGVLCTQAESIWLHMDIIEDIVSNCRQIFK 50 VIVDSSDPIGPAQELFEKPFF SVAKALRPGGV+CTQAESIWLHMDIIEDIVSNCR IFK Sbjct: 109 VIVDSSDPIGPAQELFEKPFFGSVAKALRPGGVVCTQAESIWLHMDIIEDIVSNCRHIFK 168 Query: 49 GSVNYAWTTVPTYPSG 2 GSVNYAWTTVPTYPSG Sbjct: 169 GSVNYAWTTVPTYPSG 184 >KJB31271.1 hypothetical protein B456_005G183500 [Gossypium raimondii] Length = 257 Score = 154 bits (390), Expect = 2e-45 Identities = 72/76 (94%), Positives = 75/76 (98%) Frame = -3 Query: 229 VIVDSSDPIGPAQELFEKPFFESVAKALRPGGVLCTQAESIWLHMDIIEDIVSNCRQIFK 50 +IVDSSDPIGPAQELFEKPFFESVAKALRPGGV+CTQAESIWLHM IIEDIV+NCRQIFK Sbjct: 120 IIVDSSDPIGPAQELFEKPFFESVAKALRPGGVVCTQAESIWLHMHIIEDIVANCRQIFK 179 Query: 49 GSVNYAWTTVPTYPSG 2 GSVNYAWTTVPTYPSG Sbjct: 180 GSVNYAWTTVPTYPSG 195 >GAU23958.1 hypothetical protein TSUD_183580 [Trifolium subterraneum] Length = 341 Score = 157 bits (396), Expect = 2e-45 Identities = 73/76 (96%), Positives = 76/76 (100%) Frame = -3 Query: 229 VIVDSSDPIGPAQELFEKPFFESVAKALRPGGVLCTQAESIWLHMDIIEDIVSNCRQIFK 50 VIVDSSDPIGPAQELFEKPFF+SVA+ALRPGGV+CTQAESIWLHMDIIEDIVSNCRQIFK Sbjct: 179 VIVDSSDPIGPAQELFEKPFFQSVARALRPGGVMCTQAESIWLHMDIIEDIVSNCRQIFK 238 Query: 49 GSVNYAWTTVPTYPSG 2 GSVNYAWTTVPTYPSG Sbjct: 239 GSVNYAWTTVPTYPSG 254 >ABF66657.1 spermidine synthase [Ammopiptanthus mongolicus] Length = 340 Score = 156 bits (395), Expect = 3e-45 Identities = 73/76 (96%), Positives = 76/76 (100%) Frame = -3 Query: 229 VIVDSSDPIGPAQELFEKPFFESVAKALRPGGVLCTQAESIWLHMDIIEDIVSNCRQIFK 50 VIVDSSDPIGPAQELFEKPFFESVA+ALRPGGV+CTQAESIWLHMDIIEDIV+NCRQIFK Sbjct: 203 VIVDSSDPIGPAQELFEKPFFESVARALRPGGVVCTQAESIWLHMDIIEDIVANCRQIFK 262 Query: 49 GSVNYAWTTVPTYPSG 2 GSVNYAWTTVPTYPSG Sbjct: 263 GSVNYAWTTVPTYPSG 278 >BAT74662.1 hypothetical protein VIGAN_01237500 [Vigna angularis var. angularis] Length = 334 Score = 156 bits (394), Expect = 3e-45 Identities = 73/76 (96%), Positives = 75/76 (98%) Frame = -3 Query: 229 VIVDSSDPIGPAQELFEKPFFESVAKALRPGGVLCTQAESIWLHMDIIEDIVSNCRQIFK 50 +IVDSSDPIGPAQELFEKPFF SVAKALRPGGVLCTQAESIWLHMDIIEDIV+NCRQIFK Sbjct: 197 IIVDSSDPIGPAQELFEKPFFASVAKALRPGGVLCTQAESIWLHMDIIEDIVANCRQIFK 256 Query: 49 GSVNYAWTTVPTYPSG 2 GSVNYAWTTVPTYPSG Sbjct: 257 GSVNYAWTTVPTYPSG 272 >XP_014523562.1 PREDICTED: spermidine synthase 2 [Vigna radiata var. radiata] Length = 334 Score = 156 bits (394), Expect = 3e-45 Identities = 73/76 (96%), Positives = 75/76 (98%) Frame = -3 Query: 229 VIVDSSDPIGPAQELFEKPFFESVAKALRPGGVLCTQAESIWLHMDIIEDIVSNCRQIFK 50 +IVDSSDPIGPAQELFEKPFF SVAKALRPGGVLCTQAESIWLHMDIIEDIV+NCRQIFK Sbjct: 197 IIVDSSDPIGPAQELFEKPFFASVAKALRPGGVLCTQAESIWLHMDIIEDIVANCRQIFK 256 Query: 49 GSVNYAWTTVPTYPSG 2 GSVNYAWTTVPTYPSG Sbjct: 257 GSVNYAWTTVPTYPSG 272 >XP_017408713.1 PREDICTED: spermidine synthase 2 [Vigna angularis] KOM28285.1 hypothetical protein LR48_Vigan511s010800 [Vigna angularis] Length = 334 Score = 156 bits (394), Expect = 3e-45 Identities = 73/76 (96%), Positives = 75/76 (98%) Frame = -3 Query: 229 VIVDSSDPIGPAQELFEKPFFESVAKALRPGGVLCTQAESIWLHMDIIEDIVSNCRQIFK 50 +IVDSSDPIGPAQELFEKPFF SVAKALRPGGVLCTQAESIWLHMDIIEDIV+NCRQIFK Sbjct: 197 IIVDSSDPIGPAQELFEKPFFASVAKALRPGGVLCTQAESIWLHMDIIEDIVANCRQIFK 256 Query: 49 GSVNYAWTTVPTYPSG 2 GSVNYAWTTVPTYPSG Sbjct: 257 GSVNYAWTTVPTYPSG 272 >XP_012844818.1 PREDICTED: spermidine synthase 2 [Erythranthe guttata] EYU31283.1 hypothetical protein MIMGU_mgv1a010658mg [Erythranthe guttata] Length = 306 Score = 155 bits (392), Expect = 3e-45 Identities = 73/76 (96%), Positives = 75/76 (98%) Frame = -3 Query: 229 VIVDSSDPIGPAQELFEKPFFESVAKALRPGGVLCTQAESIWLHMDIIEDIVSNCRQIFK 50 VIVDSSDPIGPAQELFEKPFF+SVAKALRPGGV+CTQAESIWLHM IIEDIVSNCRQIFK Sbjct: 173 VIVDSSDPIGPAQELFEKPFFQSVAKALRPGGVICTQAESIWLHMHIIEDIVSNCRQIFK 232 Query: 49 GSVNYAWTTVPTYPSG 2 GSVNYAWTTVPTYPSG Sbjct: 233 GSVNYAWTTVPTYPSG 248 >EPS71978.1 spermidine synthase 1, partial [Genlisea aurea] Length = 301 Score = 155 bits (391), Expect = 4e-45 Identities = 71/76 (93%), Positives = 75/76 (98%) Frame = -3 Query: 229 VIVDSSDPIGPAQELFEKPFFESVAKALRPGGVLCTQAESIWLHMDIIEDIVSNCRQIFK 50 VIVDSSDPIGPA+ELFEKPFFESVAKALRPGGV+CTQAESIWLHMDIIEDI+ NCRQ+FK Sbjct: 170 VIVDSSDPIGPAKELFEKPFFESVAKALRPGGVVCTQAESIWLHMDIIEDIIENCRQVFK 229 Query: 49 GSVNYAWTTVPTYPSG 2 GSVNYAWTTVPTYPSG Sbjct: 230 GSVNYAWTTVPTYPSG 245 >XP_003552013.1 PREDICTED: spermidine synthase 2 isoform X1 [Glycine max] KRG99325.1 hypothetical protein GLYMA_18G137100 [Glycine max] Length = 335 Score = 155 bits (393), Expect = 4e-45 Identities = 73/76 (96%), Positives = 75/76 (98%) Frame = -3 Query: 229 VIVDSSDPIGPAQELFEKPFFESVAKALRPGGVLCTQAESIWLHMDIIEDIVSNCRQIFK 50 VIVDSSDPIGPAQELFEKPFF SVAKALRPGGV+CTQAESIWLHMDIIEDIV+NCRQIFK Sbjct: 198 VIVDSSDPIGPAQELFEKPFFSSVAKALRPGGVVCTQAESIWLHMDIIEDIVANCRQIFK 257 Query: 49 GSVNYAWTTVPTYPSG 2 GSVNYAWTTVPTYPSG Sbjct: 258 GSVNYAWTTVPTYPSG 273 >ABZ01548.1 spermidine synthase X, partial [Silene latifolia] ABZ01549.1 spermidine synthase X, partial [Silene latifolia] Length = 255 Score = 153 bits (387), Expect = 5e-45 Identities = 72/76 (94%), Positives = 75/76 (98%) Frame = -3 Query: 229 VIVDSSDPIGPAQELFEKPFFESVAKALRPGGVLCTQAESIWLHMDIIEDIVSNCRQIFK 50 VIVDSSDPIGPA+ELFEKPFFESVAKALRPGGV+CTQAESIWLHM IIEDIVSNCR+IFK Sbjct: 141 VIVDSSDPIGPAKELFEKPFFESVAKALRPGGVVCTQAESIWLHMHIIEDIVSNCREIFK 200 Query: 49 GSVNYAWTTVPTYPSG 2 GSVNYAWTTVPTYPSG Sbjct: 201 GSVNYAWTTVPTYPSG 216 >ABZ01528.1 spermidine synthase X, partial [Silene latifolia] Length = 255 Score = 153 bits (387), Expect = 5e-45 Identities = 72/76 (94%), Positives = 75/76 (98%) Frame = -3 Query: 229 VIVDSSDPIGPAQELFEKPFFESVAKALRPGGVLCTQAESIWLHMDIIEDIVSNCRQIFK 50 VIVDSSDPIGPA+ELFEKPFFESVAKALRPGGV+CTQAESIWLHM IIEDIVSNCR+IFK Sbjct: 141 VIVDSSDPIGPAKELFEKPFFESVAKALRPGGVVCTQAESIWLHMHIIEDIVSNCREIFK 200 Query: 49 GSVNYAWTTVPTYPSG 2 GSVNYAWTTVPTYPSG Sbjct: 201 GSVNYAWTTVPTYPSG 216 >ABZ01527.1 spermidine synthase X, partial [Silene latifolia] Length = 255 Score = 153 bits (387), Expect = 5e-45 Identities = 72/76 (94%), Positives = 75/76 (98%) Frame = -3 Query: 229 VIVDSSDPIGPAQELFEKPFFESVAKALRPGGVLCTQAESIWLHMDIIEDIVSNCRQIFK 50 VIVDSSDPIGPA+ELFEKPFFESVAKALRPGGV+CTQAESIWLHM IIEDIVSNCR+IFK Sbjct: 141 VIVDSSDPIGPAKELFEKPFFESVAKALRPGGVVCTQAESIWLHMHIIEDIVSNCREIFK 200 Query: 49 GSVNYAWTTVPTYPSG 2 GSVNYAWTTVPTYPSG Sbjct: 201 GSVNYAWTTVPTYPSG 216 >ABZ01524.1 spermidine synthase X, partial [Silene latifolia] ABZ01525.1 spermidine synthase X, partial [Silene latifolia] ABZ01526.1 spermidine synthase X, partial [Silene latifolia] ABZ01529.1 spermidine synthase X, partial [Silene latifolia] ABZ01530.1 spermidine synthase X, partial [Silene latifolia] ABZ01531.1 spermidine synthase X, partial [Silene latifolia] ABZ01532.1 spermidine synthase X, partial [Silene latifolia] ABZ01533.1 spermidine synthase X, partial [Silene latifolia] ABZ01534.1 spermidine synthase X, partial [Silene latifolia] ABZ01535.1 spermidine synthase X, partial [Silene latifolia] ABZ01536.1 spermidine synthase X, partial [Silene latifolia] ABZ01537.1 spermidine synthase X, partial [Silene latifolia] ABZ01538.1 spermidine synthase X, partial [Silene latifolia] ABZ01539.1 spermidine synthase X, partial [Silene latifolia] ABZ01540.1 spermidine synthase X, partial [Silene latifolia] ABZ01541.1 spermidine synthase X, partial [Silene latifolia] ABZ01542.1 spermidine synthase X, partial [Silene latifolia] ABZ01543.1 spermidine synthase X, partial [Silene latifolia] ABZ01544.1 spermidine synthase X, partial [Silene latifolia] ABZ01545.1 spermidine synthase X, partial [Silene latifolia] ABZ01546.1 spermidine synthase X, partial [Silene latifolia] ABZ01547.1 spermidine synthase X, partial [Silene latifolia] ABZ01550.1 spermidine synthase X, partial [Silene latifolia] ABZ01551.1 spermidine synthase X, partial [Silene latifolia] ABZ01552.1 spermidine synthase X, partial [Silene latifolia] ABZ01553.1 spermidine synthase X, partial [Silene latifolia] ABZ01554.1 spermidine synthase X, partial [Silene latifolia] ABZ01555.1 spermidine synthase X, partial [Silene latifolia] ABZ01556.1 spermidine synthase X, partial [Silene latifolia] ABZ01557.1 spermidine synthase X, partial [Silene latifolia] ABZ01558.1 spermidine synthase X, partial [Silene latifolia] ABZ01559.1 spermidine synthase X, partial [Silene latifolia] ABZ01560.1 spermidine synthase X, partial [Silene latifolia] ABZ01561.1 spermidine synthase X, partial [Silene latifolia] ABZ01562.1 spermidine synthase X, partial [Silene latifolia] ABZ01563.1 spermidine synthase X, partial [Silene latifolia] ABZ01564.1 spermidine synthase X, partial [Silene latifolia] ABZ01565.1 spermidine synthase X, partial [Silene latifolia] Length = 255 Score = 153 bits (387), Expect = 5e-45 Identities = 72/76 (94%), Positives = 75/76 (98%) Frame = -3 Query: 229 VIVDSSDPIGPAQELFEKPFFESVAKALRPGGVLCTQAESIWLHMDIIEDIVSNCRQIFK 50 VIVDSSDPIGPA+ELFEKPFFESVAKALRPGGV+CTQAESIWLHM IIEDIVSNCR+IFK Sbjct: 141 VIVDSSDPIGPAKELFEKPFFESVAKALRPGGVVCTQAESIWLHMHIIEDIVSNCREIFK 200 Query: 49 GSVNYAWTTVPTYPSG 2 GSVNYAWTTVPTYPSG Sbjct: 201 GSVNYAWTTVPTYPSG 216 >ABZ01566.1 spermidine synthase X, partial [Silene vulgaris] Length = 255 Score = 153 bits (387), Expect = 5e-45 Identities = 72/76 (94%), Positives = 75/76 (98%) Frame = -3 Query: 229 VIVDSSDPIGPAQELFEKPFFESVAKALRPGGVLCTQAESIWLHMDIIEDIVSNCRQIFK 50 VIVDSSDPIGPA+ELFEKPFFESVAKALRPGGV+CTQAESIWLHM IIEDIVSNCR+IFK Sbjct: 141 VIVDSSDPIGPAKELFEKPFFESVAKALRPGGVVCTQAESIWLHMHIIEDIVSNCREIFK 200 Query: 49 GSVNYAWTTVPTYPSG 2 GSVNYAWTTVPTYPSG Sbjct: 201 GSVNYAWTTVPTYPSG 216 >ACB86617.1 putative spermidine synthase, partial [Silene dioica] Length = 260 Score = 153 bits (387), Expect = 5e-45 Identities = 72/76 (94%), Positives = 75/76 (98%) Frame = -3 Query: 229 VIVDSSDPIGPAQELFEKPFFESVAKALRPGGVLCTQAESIWLHMDIIEDIVSNCRQIFK 50 VIVDSSDPIGPA+ELFEKPFFESVAKALRPGGV+CTQAESIWLHM IIEDIVSNCR+IFK Sbjct: 136 VIVDSSDPIGPAKELFEKPFFESVAKALRPGGVVCTQAESIWLHMHIIEDIVSNCREIFK 195 Query: 49 GSVNYAWTTVPTYPSG 2 GSVNYAWTTVPTYPSG Sbjct: 196 GSVNYAWTTVPTYPSG 211 >ACB86613.1 putative spermidine synthase, partial [Silene conica] ACB86616.1 putative spermidine synthase, partial [Silene dioica] Length = 260 Score = 153 bits (387), Expect = 5e-45 Identities = 72/76 (94%), Positives = 75/76 (98%) Frame = -3 Query: 229 VIVDSSDPIGPAQELFEKPFFESVAKALRPGGVLCTQAESIWLHMDIIEDIVSNCRQIFK 50 VIVDSSDPIGPA+ELFEKPFFESVAKALRPGGV+CTQAESIWLHM IIEDIVSNCR+IFK Sbjct: 136 VIVDSSDPIGPAKELFEKPFFESVAKALRPGGVVCTQAESIWLHMHIIEDIVSNCREIFK 195 Query: 49 GSVNYAWTTVPTYPSG 2 GSVNYAWTTVPTYPSG Sbjct: 196 GSVNYAWTTVPTYPSG 211