BLASTX nr result
ID: Glycyrrhiza28_contig00031484
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00031484 (237 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_014622319.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 1e-07 KYP39447.1 hypothetical protein KK1_039226 [Cajanus cajan] 53 3e-06 >XP_014622319.1 PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like [Glycine max] XP_014622332.1 PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like [Glycine max] XP_014622345.1 PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like [Glycine max] XP_014622357.1 PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like [Glycine max] XP_014622368.1 PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like [Glycine max] KRH74389.1 hypothetical protein GLYMA_01G016100 [Glycine max] Length = 734 Score = 57.0 bits (136), Expect = 1e-07 Identities = 38/65 (58%), Positives = 42/65 (64%), Gaps = 2/65 (3%) Frame = -1 Query: 192 MSVICLLGRGLLRSRVHSQQHPCSFWLYSS--SALMLEEDQVFDESPKFHANFVTNSCVA 19 MS+IC LG GL+R +VH Q+ C F YSS SALMLE D VFDESPK H FV N Sbjct: 1 MSLICFLGCGLIRRQVHFQRQ-CLFRFYSSASSALMLE-DHVFDESPKSH--FVINRPAP 56 Query: 18 PVPRT 4 VP T Sbjct: 57 HVPAT 61 >KYP39447.1 hypothetical protein KK1_039226 [Cajanus cajan] Length = 732 Score = 52.8 bits (125), Expect = 3e-06 Identities = 35/60 (58%), Positives = 39/60 (65%), Gaps = 2/60 (3%) Frame = -1 Query: 177 LLGRGLLRSRVHSQQHPCSFWLYSS--SALMLEEDQVFDESPKFHANFVTNSCVAPVPRT 4 LL GLLR +VHSQ+ C F +SS SALMLE D VFDESPK +ANF N VP T Sbjct: 2 LLWCGLLRRKVHSQRQ-CFFRFHSSVSSALMLE-DHVFDESPKSYANFFINMPAPHVPTT 59