BLASTX nr result
ID: Glycyrrhiza28_contig00031305
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00031305 (260 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003522970.1 PREDICTED: phosphatidylinositol 4-kinase alpha 1-... 172 4e-48 XP_004500822.1 PREDICTED: phosphatidylinositol 4-kinase alpha 1 ... 171 6e-48 XP_004500823.1 PREDICTED: phosphatidylinositol 4-kinase alpha 1 ... 171 6e-48 XP_003603887.2 phosphatidylinositol 4-kinase alpha [Medicago tru... 171 6e-48 OIV96264.1 hypothetical protein TanjilG_05104 [Lupinus angustifo... 171 1e-47 XP_019416850.1 PREDICTED: phosphatidylinositol 4-kinase alpha 1-... 171 1e-47 XP_014632677.1 PREDICTED: LOW QUALITY PROTEIN: phosphatidylinosi... 170 2e-47 KHN20079.1 Phosphatidylinositol 4-kinase alpha [Glycine soja] 170 2e-47 KRH51547.1 hypothetical protein GLYMA_06G013800 [Glycine max] 170 2e-47 KRH51548.1 hypothetical protein GLYMA_06G013800 [Glycine max] 170 2e-47 OIW14762.1 hypothetical protein TanjilG_05383 [Lupinus angustifo... 169 5e-47 XP_019438149.1 PREDICTED: phosphatidylinositol 4-kinase alpha 1-... 169 5e-47 KYP64907.1 LOW QUALITY PROTEIN: Phosphatidylinositol 4-kinase al... 168 7e-47 XP_007135990.1 hypothetical protein PHAVU_009G009000g [Phaseolus... 168 7e-47 KOM42250.1 hypothetical protein LR48_Vigan04g244800 [Vigna angul... 164 1e-45 BAT77574.1 hypothetical protein VIGAN_02015900 [Vigna angularis ... 164 2e-45 XP_017421580.1 PREDICTED: phosphatidylinositol 4-kinase alpha 1 ... 164 2e-45 XP_014500991.1 PREDICTED: phosphatidylinositol 4-kinase alpha 1 ... 164 2e-45 XP_016167023.1 PREDICTED: phosphatidylinositol 4-kinase alpha 1 ... 163 6e-45 XP_015935245.1 PREDICTED: phosphatidylinositol 4-kinase alpha 1 ... 163 6e-45 >XP_003522970.1 PREDICTED: phosphatidylinositol 4-kinase alpha 1-like [Glycine max] KRH60863.1 hypothetical protein GLYMA_04G013900 [Glycine max] Length = 2035 Score = 172 bits (435), Expect = 4e-48 Identities = 83/86 (96%), Positives = 86/86 (100%) Frame = -2 Query: 259 PRIALSLASRFPTNAFVKTEVTQLVQAHIVDVRNIPEALPYFITPKAVDDNSVLLQQLPH 80 PR+ALSLASRFPTNAFVKTEVTQLVQA+IVDVRNIPEALPYFITPKAVDDNSVLLQQLPH Sbjct: 1501 PRLALSLASRFPTNAFVKTEVTQLVQANIVDVRNIPEALPYFITPKAVDDNSVLLQQLPH 1560 Query: 79 WAPCSITQALEFLSPSYKGHPRVMAY 2 WAPCSITQALEFLSP+YKGHPRVMAY Sbjct: 1561 WAPCSITQALEFLSPAYKGHPRVMAY 1586 >XP_004500822.1 PREDICTED: phosphatidylinositol 4-kinase alpha 1 isoform X1 [Cicer arietinum] Length = 2038 Score = 171 bits (434), Expect = 6e-48 Identities = 82/86 (95%), Positives = 85/86 (98%) Frame = -2 Query: 259 PRIALSLASRFPTNAFVKTEVTQLVQAHIVDVRNIPEALPYFITPKAVDDNSVLLQQLPH 80 PRIALS+ASRFPTN FVKTEVTQLVQAHIVDVRNIPEALPYFITPKAVDDNSVLLQQLPH Sbjct: 1504 PRIALSVASRFPTNTFVKTEVTQLVQAHIVDVRNIPEALPYFITPKAVDDNSVLLQQLPH 1563 Query: 79 WAPCSITQALEFLSPSYKGHPRVMAY 2 WAPCSITQALEFL+P+YKGHPRVMAY Sbjct: 1564 WAPCSITQALEFLTPAYKGHPRVMAY 1589 >XP_004500823.1 PREDICTED: phosphatidylinositol 4-kinase alpha 1 isoform X2 [Cicer arietinum] Length = 2037 Score = 171 bits (434), Expect = 6e-48 Identities = 82/86 (95%), Positives = 85/86 (98%) Frame = -2 Query: 259 PRIALSLASRFPTNAFVKTEVTQLVQAHIVDVRNIPEALPYFITPKAVDDNSVLLQQLPH 80 PRIALS+ASRFPTN FVKTEVTQLVQAHIVDVRNIPEALPYFITPKAVDDNSVLLQQLPH Sbjct: 1503 PRIALSVASRFPTNTFVKTEVTQLVQAHIVDVRNIPEALPYFITPKAVDDNSVLLQQLPH 1562 Query: 79 WAPCSITQALEFLSPSYKGHPRVMAY 2 WAPCSITQALEFL+P+YKGHPRVMAY Sbjct: 1563 WAPCSITQALEFLTPAYKGHPRVMAY 1588 >XP_003603887.2 phosphatidylinositol 4-kinase alpha [Medicago truncatula] AES74138.2 phosphatidylinositol 4-kinase alpha [Medicago truncatula] Length = 2035 Score = 171 bits (434), Expect = 6e-48 Identities = 82/86 (95%), Positives = 85/86 (98%) Frame = -2 Query: 259 PRIALSLASRFPTNAFVKTEVTQLVQAHIVDVRNIPEALPYFITPKAVDDNSVLLQQLPH 80 P+IALS+ASRFPTN FVKTEVTQLVQAHIVDVRNIPEALPYFITPKAVDDNSVLLQQLPH Sbjct: 1501 PKIALSVASRFPTNTFVKTEVTQLVQAHIVDVRNIPEALPYFITPKAVDDNSVLLQQLPH 1560 Query: 79 WAPCSITQALEFLSPSYKGHPRVMAY 2 WAPCSITQALEFLSP+YKGHPRVMAY Sbjct: 1561 WAPCSITQALEFLSPAYKGHPRVMAY 1586 >OIV96264.1 hypothetical protein TanjilG_05104 [Lupinus angustifolius] Length = 2308 Score = 171 bits (432), Expect = 1e-47 Identities = 80/86 (93%), Positives = 85/86 (98%) Frame = -2 Query: 259 PRIALSLASRFPTNAFVKTEVTQLVQAHIVDVRNIPEALPYFITPKAVDDNSVLLQQLPH 80 PRIALSLASRFPTNAF+KTEVTQLVQ HI+DVRN+PEALPYFITPKAVDDNSVLLQQLPH Sbjct: 1774 PRIALSLASRFPTNAFLKTEVTQLVQGHIIDVRNVPEALPYFITPKAVDDNSVLLQQLPH 1833 Query: 79 WAPCSITQALEFLSPSYKGHPRVMAY 2 WAPCSITQALEFL+P+YKGHPRVMAY Sbjct: 1834 WAPCSITQALEFLTPAYKGHPRVMAY 1859 >XP_019416850.1 PREDICTED: phosphatidylinositol 4-kinase alpha 1-like [Lupinus angustifolius] Length = 2024 Score = 171 bits (432), Expect = 1e-47 Identities = 80/86 (93%), Positives = 85/86 (98%) Frame = -2 Query: 259 PRIALSLASRFPTNAFVKTEVTQLVQAHIVDVRNIPEALPYFITPKAVDDNSVLLQQLPH 80 PRIALSLASRFPTNAF+KTEVTQLVQ HI+DVRN+PEALPYFITPKAVDDNSVLLQQLPH Sbjct: 1490 PRIALSLASRFPTNAFLKTEVTQLVQGHIIDVRNVPEALPYFITPKAVDDNSVLLQQLPH 1549 Query: 79 WAPCSITQALEFLSPSYKGHPRVMAY 2 WAPCSITQALEFL+P+YKGHPRVMAY Sbjct: 1550 WAPCSITQALEFLTPAYKGHPRVMAY 1575 >XP_014632677.1 PREDICTED: LOW QUALITY PROTEIN: phosphatidylinositol 4-kinase alpha 1-like [Glycine max] Length = 2035 Score = 170 bits (430), Expect = 2e-47 Identities = 82/86 (95%), Positives = 86/86 (100%) Frame = -2 Query: 259 PRIALSLASRFPTNAFVKTEVTQLVQAHIVDVRNIPEALPYFITPKAVDDNSVLLQQLPH 80 PR+ALSLASRFPTNAFVKTEVTQLVQA+IVDVRNIPEALPYFITPKAVDD+SVLLQQLPH Sbjct: 1501 PRLALSLASRFPTNAFVKTEVTQLVQANIVDVRNIPEALPYFITPKAVDDSSVLLQQLPH 1560 Query: 79 WAPCSITQALEFLSPSYKGHPRVMAY 2 WAPCSITQALEFLSP+YKGHPRVMAY Sbjct: 1561 WAPCSITQALEFLSPAYKGHPRVMAY 1586 >KHN20079.1 Phosphatidylinositol 4-kinase alpha [Glycine soja] Length = 2014 Score = 170 bits (430), Expect = 2e-47 Identities = 82/86 (95%), Positives = 86/86 (100%) Frame = -2 Query: 259 PRIALSLASRFPTNAFVKTEVTQLVQAHIVDVRNIPEALPYFITPKAVDDNSVLLQQLPH 80 PR+ALSLASRFPTNAFVKTEVTQLVQA+IVDVRNIPEALPYFITPKAVDD+SVLLQQLPH Sbjct: 1480 PRLALSLASRFPTNAFVKTEVTQLVQANIVDVRNIPEALPYFITPKAVDDSSVLLQQLPH 1539 Query: 79 WAPCSITQALEFLSPSYKGHPRVMAY 2 WAPCSITQALEFLSP+YKGHPRVMAY Sbjct: 1540 WAPCSITQALEFLSPAYKGHPRVMAY 1565 >KRH51547.1 hypothetical protein GLYMA_06G013800 [Glycine max] Length = 1925 Score = 170 bits (430), Expect = 2e-47 Identities = 82/86 (95%), Positives = 86/86 (100%) Frame = -2 Query: 259 PRIALSLASRFPTNAFVKTEVTQLVQAHIVDVRNIPEALPYFITPKAVDDNSVLLQQLPH 80 PR+ALSLASRFPTNAFVKTEVTQLVQA+IVDVRNIPEALPYFITPKAVDD+SVLLQQLPH Sbjct: 1501 PRLALSLASRFPTNAFVKTEVTQLVQANIVDVRNIPEALPYFITPKAVDDSSVLLQQLPH 1560 Query: 79 WAPCSITQALEFLSPSYKGHPRVMAY 2 WAPCSITQALEFLSP+YKGHPRVMAY Sbjct: 1561 WAPCSITQALEFLSPAYKGHPRVMAY 1586 >KRH51548.1 hypothetical protein GLYMA_06G013800 [Glycine max] Length = 1878 Score = 170 bits (430), Expect = 2e-47 Identities = 82/86 (95%), Positives = 86/86 (100%) Frame = -2 Query: 259 PRIALSLASRFPTNAFVKTEVTQLVQAHIVDVRNIPEALPYFITPKAVDDNSVLLQQLPH 80 PR+ALSLASRFPTNAFVKTEVTQLVQA+IVDVRNIPEALPYFITPKAVDD+SVLLQQLPH Sbjct: 1501 PRLALSLASRFPTNAFVKTEVTQLVQANIVDVRNIPEALPYFITPKAVDDSSVLLQQLPH 1560 Query: 79 WAPCSITQALEFLSPSYKGHPRVMAY 2 WAPCSITQALEFLSP+YKGHPRVMAY Sbjct: 1561 WAPCSITQALEFLSPAYKGHPRVMAY 1586 >OIW14762.1 hypothetical protein TanjilG_05383 [Lupinus angustifolius] Length = 2030 Score = 169 bits (427), Expect = 5e-47 Identities = 81/86 (94%), Positives = 85/86 (98%) Frame = -2 Query: 259 PRIALSLASRFPTNAFVKTEVTQLVQAHIVDVRNIPEALPYFITPKAVDDNSVLLQQLPH 80 PRIALSLASRFPTNAF+KTEVTQLVQAHI+DVRNIPEAL YFITPKAVDDNSVLLQQLPH Sbjct: 1485 PRIALSLASRFPTNAFLKTEVTQLVQAHILDVRNIPEALSYFITPKAVDDNSVLLQQLPH 1544 Query: 79 WAPCSITQALEFLSPSYKGHPRVMAY 2 WAPCSITQALEFL+P+YKGHPRVMAY Sbjct: 1545 WAPCSITQALEFLTPAYKGHPRVMAY 1570 >XP_019438149.1 PREDICTED: phosphatidylinositol 4-kinase alpha 1-like [Lupinus angustifolius] Length = 2019 Score = 169 bits (427), Expect = 5e-47 Identities = 81/86 (94%), Positives = 85/86 (98%) Frame = -2 Query: 259 PRIALSLASRFPTNAFVKTEVTQLVQAHIVDVRNIPEALPYFITPKAVDDNSVLLQQLPH 80 PRIALSLASRFPTNAF+KTEVTQLVQAHI+DVRNIPEAL YFITPKAVDDNSVLLQQLPH Sbjct: 1485 PRIALSLASRFPTNAFLKTEVTQLVQAHILDVRNIPEALSYFITPKAVDDNSVLLQQLPH 1544 Query: 79 WAPCSITQALEFLSPSYKGHPRVMAY 2 WAPCSITQALEFL+P+YKGHPRVMAY Sbjct: 1545 WAPCSITQALEFLTPAYKGHPRVMAY 1570 >KYP64907.1 LOW QUALITY PROTEIN: Phosphatidylinositol 4-kinase alpha [Cajanus cajan] Length = 2077 Score = 168 bits (426), Expect = 7e-47 Identities = 81/86 (94%), Positives = 85/86 (98%) Frame = -2 Query: 259 PRIALSLASRFPTNAFVKTEVTQLVQAHIVDVRNIPEALPYFITPKAVDDNSVLLQQLPH 80 PRIALSLASRFP N+FVKTEVTQLVQA+IVDVRNIPEALPYFITPKAVDDNSVLLQQLPH Sbjct: 1543 PRIALSLASRFPANSFVKTEVTQLVQANIVDVRNIPEALPYFITPKAVDDNSVLLQQLPH 1602 Query: 79 WAPCSITQALEFLSPSYKGHPRVMAY 2 WAPCSITQALEFL+P+YKGHPRVMAY Sbjct: 1603 WAPCSITQALEFLTPAYKGHPRVMAY 1628 >XP_007135990.1 hypothetical protein PHAVU_009G009000g [Phaseolus vulgaris] ESW07984.1 hypothetical protein PHAVU_009G009000g [Phaseolus vulgaris] Length = 2033 Score = 168 bits (426), Expect = 7e-47 Identities = 81/86 (94%), Positives = 85/86 (98%) Frame = -2 Query: 259 PRIALSLASRFPTNAFVKTEVTQLVQAHIVDVRNIPEALPYFITPKAVDDNSVLLQQLPH 80 PRIALSLASRFPTN FVKTEVTQLVQA+IVDVRNIPEALP+FITPKAVDDNSVLLQQLPH Sbjct: 1499 PRIALSLASRFPTNTFVKTEVTQLVQANIVDVRNIPEALPFFITPKAVDDNSVLLQQLPH 1558 Query: 79 WAPCSITQALEFLSPSYKGHPRVMAY 2 WAPCSITQALEFL+P+YKGHPRVMAY Sbjct: 1559 WAPCSITQALEFLTPAYKGHPRVMAY 1584 >KOM42250.1 hypothetical protein LR48_Vigan04g244800 [Vigna angularis] Length = 797 Score = 164 bits (416), Expect = 1e-45 Identities = 78/86 (90%), Positives = 84/86 (97%) Frame = -2 Query: 259 PRIALSLASRFPTNAFVKTEVTQLVQAHIVDVRNIPEALPYFITPKAVDDNSVLLQQLPH 80 PRIALSLASRFP+N F+KTEVTQLVQ +IVDVRNIPEALP+FITPKAVDDNSVLLQQLPH Sbjct: 186 PRIALSLASRFPSNTFIKTEVTQLVQENIVDVRNIPEALPFFITPKAVDDNSVLLQQLPH 245 Query: 79 WAPCSITQALEFLSPSYKGHPRVMAY 2 WAPCSITQALEFL+P+YKGHPRVMAY Sbjct: 246 WAPCSITQALEFLTPAYKGHPRVMAY 271 >BAT77574.1 hypothetical protein VIGAN_02015900 [Vigna angularis var. angularis] Length = 2035 Score = 164 bits (416), Expect = 2e-45 Identities = 78/86 (90%), Positives = 84/86 (97%) Frame = -2 Query: 259 PRIALSLASRFPTNAFVKTEVTQLVQAHIVDVRNIPEALPYFITPKAVDDNSVLLQQLPH 80 PRIALSLASRFP+N F+KTEVTQLVQ +IVDVRNIPEALP+FITPKAVDDNSVLLQQLPH Sbjct: 1500 PRIALSLASRFPSNTFIKTEVTQLVQENIVDVRNIPEALPFFITPKAVDDNSVLLQQLPH 1559 Query: 79 WAPCSITQALEFLSPSYKGHPRVMAY 2 WAPCSITQALEFL+P+YKGHPRVMAY Sbjct: 1560 WAPCSITQALEFLTPAYKGHPRVMAY 1585 >XP_017421580.1 PREDICTED: phosphatidylinositol 4-kinase alpha 1 [Vigna angularis] Length = 2034 Score = 164 bits (416), Expect = 2e-45 Identities = 78/86 (90%), Positives = 84/86 (97%) Frame = -2 Query: 259 PRIALSLASRFPTNAFVKTEVTQLVQAHIVDVRNIPEALPYFITPKAVDDNSVLLQQLPH 80 PRIALSLASRFP+N F+KTEVTQLVQ +IVDVRNIPEALP+FITPKAVDDNSVLLQQLPH Sbjct: 1500 PRIALSLASRFPSNTFIKTEVTQLVQENIVDVRNIPEALPFFITPKAVDDNSVLLQQLPH 1559 Query: 79 WAPCSITQALEFLSPSYKGHPRVMAY 2 WAPCSITQALEFL+P+YKGHPRVMAY Sbjct: 1560 WAPCSITQALEFLTPAYKGHPRVMAY 1585 >XP_014500991.1 PREDICTED: phosphatidylinositol 4-kinase alpha 1 [Vigna radiata var. radiata] Length = 2034 Score = 164 bits (416), Expect = 2e-45 Identities = 78/86 (90%), Positives = 84/86 (97%) Frame = -2 Query: 259 PRIALSLASRFPTNAFVKTEVTQLVQAHIVDVRNIPEALPYFITPKAVDDNSVLLQQLPH 80 PRIALSLASRFP+N F+KTEVTQLVQ +IVDVRNIPEALP+FITPKAVDDNSVLLQQLPH Sbjct: 1500 PRIALSLASRFPSNTFIKTEVTQLVQENIVDVRNIPEALPFFITPKAVDDNSVLLQQLPH 1559 Query: 79 WAPCSITQALEFLSPSYKGHPRVMAY 2 WAPCSITQALEFL+P+YKGHPRVMAY Sbjct: 1560 WAPCSITQALEFLTPAYKGHPRVMAY 1585 >XP_016167023.1 PREDICTED: phosphatidylinositol 4-kinase alpha 1 [Arachis ipaensis] Length = 1999 Score = 163 bits (413), Expect = 6e-45 Identities = 78/86 (90%), Positives = 84/86 (97%) Frame = -2 Query: 259 PRIALSLASRFPTNAFVKTEVTQLVQAHIVDVRNIPEALPYFITPKAVDDNSVLLQQLPH 80 P+IALSLA RFPTN+ VKTEVTQLVQAHI+DVR++PEALPYFITPKAVDDNSVLLQQLPH Sbjct: 1465 PKIALSLALRFPTNSSVKTEVTQLVQAHILDVRSMPEALPYFITPKAVDDNSVLLQQLPH 1524 Query: 79 WAPCSITQALEFLSPSYKGHPRVMAY 2 WAPCSITQALEFLSP+YKGHPRVMAY Sbjct: 1525 WAPCSITQALEFLSPAYKGHPRVMAY 1550 >XP_015935245.1 PREDICTED: phosphatidylinositol 4-kinase alpha 1 [Arachis duranensis] Length = 1999 Score = 163 bits (413), Expect = 6e-45 Identities = 78/86 (90%), Positives = 84/86 (97%) Frame = -2 Query: 259 PRIALSLASRFPTNAFVKTEVTQLVQAHIVDVRNIPEALPYFITPKAVDDNSVLLQQLPH 80 P+IALSLA RFPTN+ VKTEVTQLVQAHI+DVR++PEALPYFITPKAVDDNSVLLQQLPH Sbjct: 1465 PKIALSLALRFPTNSSVKTEVTQLVQAHILDVRSMPEALPYFITPKAVDDNSVLLQQLPH 1524 Query: 79 WAPCSITQALEFLSPSYKGHPRVMAY 2 WAPCSITQALEFLSP+YKGHPRVMAY Sbjct: 1525 WAPCSITQALEFLSPAYKGHPRVMAY 1550