BLASTX nr result
ID: Glycyrrhiza28_contig00031243
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00031243 (309 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_024584841.1 MULTISPECIES: nucleoside diphosphate kinase regul... 58 2e-08 ERF82450.1 hypothetical protein C207_04333 [Bradyrhizobium sp. D... 52 5e-06 >WP_024584841.1 MULTISPECIES: nucleoside diphosphate kinase regulator [Bradyrhizobium] KIU51227.1 nucleoside diphosphate kinase regulator [Bradyrhizobium elkanii] OCX28230.1 nucleoside diphosphate kinase regulator [Bradyrhizobium sp. UASWS1016] Length = 139 Score = 57.8 bits (138), Expect = 2e-08 Identities = 33/49 (67%), Positives = 33/49 (67%) Frame = -1 Query: 147 MTQSIQNSFSAATLPPIVIXXXXXXXXXXXXXXXXAVFPRVAQFLARET 1 MTQSIQNSFSAATLPPIVI AVFPRVAQFLARET Sbjct: 1 MTQSIQNSFSAATLPPIVIAASEALRLSALADSSMAVFPRVAQFLARET 49 >ERF82450.1 hypothetical protein C207_04333 [Bradyrhizobium sp. DFCI-1] Length = 139 Score = 51.6 bits (122), Expect = 5e-06 Identities = 30/49 (61%), Positives = 30/49 (61%) Frame = -1 Query: 147 MTQSIQNSFSAATLPPIVIXXXXXXXXXXXXXXXXAVFPRVAQFLARET 1 M QSIQN FSAA LPPIVI AVFPRVAQFLARET Sbjct: 1 MPQSIQNRFSAAALPPIVITASEAHRLSALADSSMAVFPRVAQFLARET 49