BLASTX nr result
ID: Glycyrrhiza28_contig00030950
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00030950 (269 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019422844.1 PREDICTED: pentatricopeptide repeat-containing pr... 159 4e-45 KYP32626.1 Pentatricopeptide repeat-containing protein At5g15300... 154 2e-44 KOM46255.1 hypothetical protein LR48_Vigan06g156100 [Vigna angul... 145 3e-42 KHN44640.1 Pentatricopeptide repeat-containing protein [Glycine ... 151 5e-42 XP_003598017.1 PPR containing plant-like protein [Medicago trunc... 151 6e-42 XP_006593838.1 PREDICTED: pentatricopeptide repeat-containing pr... 151 8e-42 XP_007153010.1 hypothetical protein PHAVU_003G000100g [Phaseolus... 151 8e-42 GAU22227.1 hypothetical protein TSUD_227630 [Trifolium subterran... 150 1e-41 XP_014520545.1 PREDICTED: pentatricopeptide repeat-containing pr... 149 6e-41 XP_017426969.1 PREDICTED: pentatricopeptide repeat-containing pr... 145 1e-39 XP_015883451.1 PREDICTED: pentatricopeptide repeat-containing pr... 145 1e-39 XP_004508136.1 PREDICTED: pentatricopeptide repeat-containing pr... 145 1e-39 XP_015571974.1 PREDICTED: pentatricopeptide repeat-containing pr... 140 2e-39 XP_016200372.1 PREDICTED: pentatricopeptide repeat-containing pr... 142 8e-39 XP_015966126.1 PREDICTED: pentatricopeptide repeat-containing pr... 142 1e-38 XP_008453215.2 PREDICTED: pentatricopeptide repeat-containing pr... 140 9e-38 XP_012080291.1 PREDICTED: pentatricopeptide repeat-containing pr... 139 1e-37 OAY47598.1 hypothetical protein MANES_06G090600 [Manihot esculenta] 139 2e-37 XP_008374561.1 PREDICTED: pentatricopeptide repeat-containing pr... 135 4e-36 CBI15206.3 unnamed protein product, partial [Vitis vinifera] 134 8e-36 >XP_019422844.1 PREDICTED: pentatricopeptide repeat-containing protein At1g59720, chloroplastic/mitochondrial-like [Lupinus angustifolius] OIV93228.1 hypothetical protein TanjilG_27407 [Lupinus angustifolius] Length = 463 Score = 159 bits (403), Expect = 4e-45 Identities = 73/89 (82%), Positives = 84/89 (94%) Frame = +3 Query: 3 VDLLGRAGLVEEAYKLIKNMPVECINAIVWRILLAACRIHGNIELGEKVREHLIELEPNH 182 VDL GRAGL++E Y+LIK MPVEC+NAIVWR LLAACRIHGN+ELGEKVR+H++ELEP+H Sbjct: 355 VDLFGRAGLLDEGYRLIKEMPVECVNAIVWRTLLAACRIHGNVELGEKVRKHVLELEPDH 414 Query: 183 SSDYVLLANMYASTGQWDEMRKERRSMQE 269 SSDYVLLANMYASTG+W+EM KERRSMQE Sbjct: 415 SSDYVLLANMYASTGRWNEMSKERRSMQE 443 >KYP32626.1 Pentatricopeptide repeat-containing protein At5g15300 family [Cajanus cajan] Length = 306 Score = 154 bits (388), Expect = 2e-44 Identities = 75/88 (85%), Positives = 82/88 (93%) Frame = +3 Query: 3 VDLLGRAGLVEEAYKLIKNMPVECINAIVWRILLAACRIHGNIELGEKVREHLIELEPNH 182 VDLLGRAGLVEEAY LIK+MPVEC NAIVWR LL ACR+HG +ELGEKVR+HL+ELEP+H Sbjct: 206 VDLLGRAGLVEEAYNLIKSMPVEC-NAIVWRTLLVACRLHGCVELGEKVRKHLLELEPDH 264 Query: 183 SSDYVLLANMYASTGQWDEMRKERRSMQ 266 SSDYVLLANMYASTGQW+EM KERRSMQ Sbjct: 265 SSDYVLLANMYASTGQWNEMSKERRSMQ 292 >KOM46255.1 hypothetical protein LR48_Vigan06g156100 [Vigna angularis] Length = 202 Score = 145 bits (366), Expect = 3e-42 Identities = 71/90 (78%), Positives = 82/90 (91%), Gaps = 1/90 (1%) Frame = +3 Query: 3 VDLLGRAGLVEEAYKLIKNMPVECINAIVWRILLAACRIHGNIELGEKVREHLIELEP-N 179 VDLLGRAGLV++AY LIKNMPVEC NAIVWR LLAACR+HGN++LGEK+R HL+ELEP + Sbjct: 85 VDLLGRAGLVDDAYNLIKNMPVEC-NAIVWRTLLAACRLHGNVQLGEKIRNHLLELEPDD 143 Query: 180 HSSDYVLLANMYASTGQWDEMRKERRSMQE 269 HSSDYVLLAN+YASTGQW+EM KER MQ+ Sbjct: 144 HSSDYVLLANVYASTGQWNEMSKERILMQK 173 >KHN44640.1 Pentatricopeptide repeat-containing protein [Glycine soja] Length = 454 Score = 151 bits (381), Expect = 5e-42 Identities = 71/89 (79%), Positives = 83/89 (93%) Frame = +3 Query: 3 VDLLGRAGLVEEAYKLIKNMPVECINAIVWRILLAACRIHGNIELGEKVREHLIELEPNH 182 VDLLGRAGLVE+AY LIKNMP+EC NA+VWR LLAACR+ G++ELGEKVR+HL+ELEP+H Sbjct: 338 VDLLGRAGLVEDAYNLIKNMPIEC-NAVVWRTLLAACRLQGHVELGEKVRKHLLELEPDH 396 Query: 183 SSDYVLLANMYASTGQWDEMRKERRSMQE 269 SSDYVLLANMYAS GQW+EM +ERRSMQ+ Sbjct: 397 SSDYVLLANMYASAGQWNEMSEERRSMQQ 425 >XP_003598017.1 PPR containing plant-like protein [Medicago truncatula] AES68268.1 PPR containing plant-like protein [Medicago truncatula] Length = 479 Score = 151 bits (382), Expect = 6e-42 Identities = 74/89 (83%), Positives = 83/89 (93%) Frame = +3 Query: 3 VDLLGRAGLVEEAYKLIKNMPVECINAIVWRILLAACRIHGNIELGEKVREHLIELEPNH 182 VDLLGRAGL EAY+LIK+MPVEC NAI+WR LLAACR +GN+ELGEKVR+HL+ELEP+H Sbjct: 363 VDLLGRAGLFVEAYELIKSMPVEC-NAIIWRTLLAACRNYGNVELGEKVRKHLMELEPDH 421 Query: 183 SSDYVLLANMYASTGQWDEMRKERRSMQE 269 SSDYVLLANMYASTGQW+EM KERRSMQE Sbjct: 422 SSDYVLLANMYASTGQWNEMSKERRSMQE 450 >XP_006593838.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Glycine max] XP_006593839.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Glycine max] KRH17575.1 hypothetical protein GLYMA_13G001700 [Glycine max] Length = 478 Score = 151 bits (381), Expect = 8e-42 Identities = 71/89 (79%), Positives = 83/89 (93%) Frame = +3 Query: 3 VDLLGRAGLVEEAYKLIKNMPVECINAIVWRILLAACRIHGNIELGEKVREHLIELEPNH 182 VDLLGRAGLVE+AY LIKNMP+EC NA+VWR LLAACR+ G++ELGEKVR+HL+ELEP+H Sbjct: 362 VDLLGRAGLVEDAYNLIKNMPIEC-NAVVWRTLLAACRLQGHVELGEKVRKHLLELEPDH 420 Query: 183 SSDYVLLANMYASTGQWDEMRKERRSMQE 269 SSDYVLLANMYAS GQW+EM +ERRSMQ+ Sbjct: 421 SSDYVLLANMYASAGQWNEMSEERRSMQQ 449 >XP_007153010.1 hypothetical protein PHAVU_003G000100g [Phaseolus vulgaris] ESW25004.1 hypothetical protein PHAVU_003G000100g [Phaseolus vulgaris] Length = 478 Score = 151 bits (381), Expect = 8e-42 Identities = 71/89 (79%), Positives = 82/89 (92%) Frame = +3 Query: 3 VDLLGRAGLVEEAYKLIKNMPVECINAIVWRILLAACRIHGNIELGEKVREHLIELEPNH 182 VDLLGRAGLV++AY LIKNMPVEC NAIVWR LLAACR+HGN++LGEK+R HL+ELEP+H Sbjct: 363 VDLLGRAGLVDDAYNLIKNMPVEC-NAIVWRTLLAACRLHGNVQLGEKIRNHLLELEPDH 421 Query: 183 SSDYVLLANMYASTGQWDEMRKERRSMQE 269 SSDYVLLAN+YASTG W+EM KERR MQ+ Sbjct: 422 SSDYVLLANVYASTGLWNEMHKERRLMQQ 450 >GAU22227.1 hypothetical protein TSUD_227630 [Trifolium subterraneum] Length = 465 Score = 150 bits (379), Expect = 1e-41 Identities = 72/89 (80%), Positives = 83/89 (93%) Frame = +3 Query: 3 VDLLGRAGLVEEAYKLIKNMPVECINAIVWRILLAACRIHGNIELGEKVREHLIELEPNH 182 VDLLGRAGLV EAY+LIK+MP+EC NAI+WR LLAACRI+GN+ELGEKVR+ L+ELEP+H Sbjct: 349 VDLLGRAGLVVEAYRLIKSMPIEC-NAIIWRTLLAACRIYGNVELGEKVRKQLLELEPDH 407 Query: 183 SSDYVLLANMYASTGQWDEMRKERRSMQE 269 SSDYVLLANMYASTGQW++M ERRSMQE Sbjct: 408 SSDYVLLANMYASTGQWNQMSNERRSMQE 436 >XP_014520545.1 PREDICTED: pentatricopeptide repeat-containing protein At1g59720, chloroplastic/mitochondrial-like [Vigna radiata var. radiata] Length = 480 Score = 149 bits (375), Expect = 6e-41 Identities = 72/90 (80%), Positives = 83/90 (92%), Gaps = 1/90 (1%) Frame = +3 Query: 3 VDLLGRAGLVEEAYKLIKNMPVECINAIVWRILLAACRIHGNIELGEKVREHLIELEP-N 179 VDLLGRAGLV++AY LIKNMPVEC NAIVWR LLAACR+HGN++LGEK+R HL+ELEP + Sbjct: 363 VDLLGRAGLVDDAYNLIKNMPVEC-NAIVWRTLLAACRLHGNVQLGEKIRNHLLELEPDD 421 Query: 180 HSSDYVLLANMYASTGQWDEMRKERRSMQE 269 HSSDYVLLAN+YASTGQW+EM KERR MQ+ Sbjct: 422 HSSDYVLLANVYASTGQWNEMSKERRLMQQ 451 >XP_017426969.1 PREDICTED: pentatricopeptide repeat-containing protein At1g59720, chloroplastic/mitochondrial-like [Vigna angularis] BAT98863.1 hypothetical protein VIGAN_10022000 [Vigna angularis var. angularis] Length = 480 Score = 145 bits (366), Expect = 1e-39 Identities = 71/90 (78%), Positives = 82/90 (91%), Gaps = 1/90 (1%) Frame = +3 Query: 3 VDLLGRAGLVEEAYKLIKNMPVECINAIVWRILLAACRIHGNIELGEKVREHLIELEP-N 179 VDLLGRAGLV++AY LIKNMPVEC NAIVWR LLAACR+HGN++LGEK+R HL+ELEP + Sbjct: 363 VDLLGRAGLVDDAYNLIKNMPVEC-NAIVWRTLLAACRLHGNVQLGEKIRNHLLELEPDD 421 Query: 180 HSSDYVLLANMYASTGQWDEMRKERRSMQE 269 HSSDYVLLAN+YASTGQW+EM KER MQ+ Sbjct: 422 HSSDYVLLANVYASTGQWNEMSKERILMQK 451 >XP_015883451.1 PREDICTED: pentatricopeptide repeat-containing protein At1g59720, chloroplastic/mitochondrial-like [Ziziphus jujuba] Length = 511 Score = 145 bits (367), Expect = 1e-39 Identities = 69/88 (78%), Positives = 82/88 (93%) Frame = +3 Query: 3 VDLLGRAGLVEEAYKLIKNMPVECINAIVWRILLAACRIHGNIELGEKVREHLIELEPNH 182 VD+L RAGLV+EAY LI++MP+EC NAIVWR LLAACR+HGNIELGEKVR+HL+ELEP+H Sbjct: 375 VDILARAGLVDEAYLLIRSMPMEC-NAIVWRTLLAACRLHGNIELGEKVRKHLLELEPDH 433 Query: 183 SSDYVLLANMYASTGQWDEMRKERRSMQ 266 SSDYVLLANMYAS GQW++M +ER+SMQ Sbjct: 434 SSDYVLLANMYASMGQWNDMLRERKSMQ 461 >XP_004508136.1 PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like [Cicer arietinum] XP_004508137.1 PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like [Cicer arietinum] XP_004508138.1 PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like [Cicer arietinum] XP_004508139.1 PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like [Cicer arietinum] Length = 471 Score = 145 bits (365), Expect = 1e-39 Identities = 70/89 (78%), Positives = 80/89 (89%) Frame = +3 Query: 3 VDLLGRAGLVEEAYKLIKNMPVECINAIVWRILLAACRIHGNIELGEKVREHLIELEPNH 182 VDLLGRAGLV EAY+LIK+M +EC NAI+WR LLAACR +GN+ELGEKVR+HL+ELEP+H Sbjct: 362 VDLLGRAGLVVEAYRLIKHMSIEC-NAIIWRTLLAACRSYGNVELGEKVRKHLLELEPDH 420 Query: 183 SSDYVLLANMYASTGQWDEMRKERRSMQE 269 SSDYVLLAN YASTG+W EM ERRSMQE Sbjct: 421 SSDYVLLANTYASTGRWSEMSNERRSMQE 449 >XP_015571974.1 PREDICTED: pentatricopeptide repeat-containing protein At5g56310 [Ricinus communis] Length = 301 Score = 140 bits (354), Expect = 2e-39 Identities = 66/89 (74%), Positives = 78/89 (87%) Frame = +3 Query: 3 VDLLGRAGLVEEAYKLIKNMPVECINAIVWRILLAACRIHGNIELGEKVREHLIELEPNH 182 VD+LGRAG VEEAY LI +MP+EC N I+WR LLAACR+HGN+ELGEKVR HL+ELEP+H Sbjct: 192 VDILGRAGFVEEAYGLISSMPMEC-NPIIWRTLLAACRLHGNVELGEKVRRHLLELEPDH 250 Query: 183 SSDYVLLANMYASTGQWDEMRKERRSMQE 269 SSDYVLLANMYAS GQW+E+ + R SMQ+ Sbjct: 251 SSDYVLLANMYASMGQWNEVMRVRNSMQK 279 >XP_016200372.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Arachis ipaensis] Length = 452 Score = 142 bits (359), Expect = 8e-39 Identities = 68/89 (76%), Positives = 82/89 (92%) Frame = +3 Query: 3 VDLLGRAGLVEEAYKLIKNMPVECINAIVWRILLAACRIHGNIELGEKVREHLIELEPNH 182 VDLLGRAGLVEEAY+LIK+MP+EC +A+VWR LLAACR+HGNI LG+KVR HL+EL+ +H Sbjct: 357 VDLLGRAGLVEEAYRLIKSMPMEC-DAVVWRTLLAACRVHGNILLGKKVRSHLLELKADH 415 Query: 183 SSDYVLLANMYASTGQWDEMRKERRSMQE 269 SSDYVLLA+MYAS GQW+EM +ER+SMQE Sbjct: 416 SSDYVLLASMYASRGQWNEMSRERKSMQE 444 >XP_015966126.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Arachis duranensis] Length = 464 Score = 142 bits (359), Expect = 1e-38 Identities = 68/89 (76%), Positives = 82/89 (92%) Frame = +3 Query: 3 VDLLGRAGLVEEAYKLIKNMPVECINAIVWRILLAACRIHGNIELGEKVREHLIELEPNH 182 VDLLGRAGLVEEAY+LIK+MP+EC +A+VWR LLAACR+HGNI LG+KVR HL+EL+ +H Sbjct: 357 VDLLGRAGLVEEAYRLIKSMPMEC-DAVVWRTLLAACRVHGNILLGKKVRSHLLELKADH 415 Query: 183 SSDYVLLANMYASTGQWDEMRKERRSMQE 269 SSDYVLLA+MYAS GQW+EM +ER+SMQE Sbjct: 416 SSDYVLLASMYASRGQWNEMSRERKSMQE 444 >XP_008453215.2 PREDICTED: pentatricopeptide repeat-containing protein At1g59720, chloroplastic/mitochondrial [Cucumis melo] Length = 506 Score = 140 bits (354), Expect = 9e-38 Identities = 63/89 (70%), Positives = 82/89 (92%) Frame = +3 Query: 3 VDLLGRAGLVEEAYKLIKNMPVECINAIVWRILLAACRIHGNIELGEKVREHLIELEPNH 182 VD+LGRAG VEEAY+LIK+MP+EC NA++WR LLAAC++HGN++LGE+V H++E+EP+H Sbjct: 401 VDILGRAGFVEEAYQLIKSMPMEC-NAVIWRTLLAACQMHGNVKLGERVSSHVLEIEPDH 459 Query: 183 SSDYVLLANMYASTGQWDEMRKERRSMQE 269 SSDYVLLANMYAS+GQW+EM K R+SMQ+ Sbjct: 460 SSDYVLLANMYASSGQWNEMIKTRKSMQQ 488 >XP_012080291.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21065 [Jatropha curcas] KDP31272.1 hypothetical protein JCGZ_11648 [Jatropha curcas] Length = 451 Score = 139 bits (351), Expect = 1e-37 Identities = 64/89 (71%), Positives = 82/89 (92%) Frame = +3 Query: 3 VDLLGRAGLVEEAYKLIKNMPVECINAIVWRILLAACRIHGNIELGEKVREHLIELEPNH 182 VD+LGRAG V EAY+LI++MP+EC NAIVWRI LAACR+HGN+ELGE+VR+HL+EL P+H Sbjct: 343 VDILGRAGFVVEAYELIRSMPMEC-NAIVWRISLAACRLHGNVELGEQVRKHLLELAPDH 401 Query: 183 SSDYVLLANMYASTGQWDEMRKERRSMQE 269 SSDYVLL+N+YAS GQW+E+ +ER+SMQ+ Sbjct: 402 SSDYVLLSNIYASVGQWNEVARERKSMQK 430 >OAY47598.1 hypothetical protein MANES_06G090600 [Manihot esculenta] Length = 452 Score = 139 bits (350), Expect = 2e-37 Identities = 63/89 (70%), Positives = 80/89 (89%) Frame = +3 Query: 3 VDLLGRAGLVEEAYKLIKNMPVECINAIVWRILLAACRIHGNIELGEKVREHLIELEPNH 182 VD+LGRAG VEEAY L+ NMP++C NAIVWR LLAACR+HGN+ELG+KVR HL++L+PNH Sbjct: 343 VDILGRAGFVEEAYGLVSNMPMDC-NAIVWRTLLAACRLHGNVELGKKVRRHLLQLDPNH 401 Query: 183 SSDYVLLANMYASTGQWDEMRKERRSMQE 269 SSDYVLL+++YAS GQW+E+ K R+SMQ+ Sbjct: 402 SSDYVLLSSIYASAGQWNEVMKVRKSMQK 430 >XP_008374561.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Malus domestica] Length = 455 Score = 135 bits (341), Expect = 4e-36 Identities = 63/87 (72%), Positives = 78/87 (89%) Frame = +3 Query: 3 VDLLGRAGLVEEAYKLIKNMPVECINAIVWRILLAACRIHGNIELGEKVREHLIELEPNH 182 VD+LGRAG VEEAY+LIKNMP+EC NA+ WR LL ACR+HG+I LGEKVR HL+ELEP+H Sbjct: 355 VDMLGRAGYVEEAYRLIKNMPMEC-NAVTWRTLLGACRLHGDIVLGEKVRGHLLELEPDH 413 Query: 183 SSDYVLLANMYASTGQWDEMRKERRSM 263 SSDYVLL+NMYAS+G+W+E+ + R+SM Sbjct: 414 SSDYVLLSNMYASSGEWNEVIRVRKSM 440 >CBI15206.3 unnamed protein product, partial [Vitis vinifera] Length = 416 Score = 134 bits (337), Expect = 8e-36 Identities = 63/87 (72%), Positives = 79/87 (90%) Frame = +3 Query: 3 VDLLGRAGLVEEAYKLIKNMPVECINAIVWRILLAACRIHGNIELGEKVREHLIELEPNH 182 VD+LGRAGLVEEAY+LIK+MP+E N+IVWR LLAACR+HGN+EL E+VR+ L+ELEP+H Sbjct: 297 VDILGRAGLVEEAYRLIKSMPIES-NSIVWRTLLAACRVHGNLELAEQVRQQLLELEPDH 355 Query: 183 SSDYVLLANMYASTGQWDEMRKERRSM 263 SSDYVLLANMYAS GQW+++ + R+SM Sbjct: 356 SSDYVLLANMYASAGQWNKVVRVRKSM 382