BLASTX nr result
ID: Glycyrrhiza28_contig00030944
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00030944 (316 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007137989.1 hypothetical protein PHAVU_009G171600g [Phaseolus... 61 9e-09 XP_014498571.1 PREDICTED: probable galactinol--sucrose galactosy... 60 3e-08 XP_017420724.1 PREDICTED: probable galactinol--sucrose galactosy... 60 3e-08 XP_014498570.1 PREDICTED: probable galactinol--sucrose galactosy... 60 3e-08 KYP46630.1 putative glycosyltransferase At1g55740 family [Cajanu... 59 8e-08 GAU40423.1 hypothetical protein TSUD_136700 [Trifolium subterran... 54 5e-06 XP_013460983.1 raffinose synthase or seed inhibition protein [Me... 53 7e-06 >XP_007137989.1 hypothetical protein PHAVU_009G171600g [Phaseolus vulgaris] ESW09983.1 hypothetical protein PHAVU_009G171600g [Phaseolus vulgaris] Length = 675 Score = 61.2 bits (147), Expect = 9e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -2 Query: 306 EEEEFSYNPEDGLLTIKLDGEEGNSRDIEFVY 211 +EEEFSYNPEDGLLTIKLDG EGNSRDIEFVY Sbjct: 645 KEEEFSYNPEDGLLTIKLDG-EGNSRDIEFVY 675 >XP_014498571.1 PREDICTED: probable galactinol--sucrose galactosyltransferase 2 isoform X2 [Vigna radiata var. radiata] Length = 749 Score = 59.7 bits (143), Expect = 3e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 306 EEEEFSYNPEDGLLTIKLDGEEGNSRDIEFVY 211 +EEEFSYNPEDGLLT KLDG EGNSRDIEFVY Sbjct: 719 KEEEFSYNPEDGLLTFKLDG-EGNSRDIEFVY 749 >XP_017420724.1 PREDICTED: probable galactinol--sucrose galactosyltransferase 2 [Vigna angularis] KOM40499.1 hypothetical protein LR48_Vigan04g069700 [Vigna angularis] BAT79443.1 hypothetical protein VIGAN_02233200 [Vigna angularis var. angularis] Length = 749 Score = 59.7 bits (143), Expect = 3e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 306 EEEEFSYNPEDGLLTIKLDGEEGNSRDIEFVY 211 +EEEFSYNPEDGLLT KLDG EGNSRDIEFVY Sbjct: 719 KEEEFSYNPEDGLLTFKLDG-EGNSRDIEFVY 749 >XP_014498570.1 PREDICTED: probable galactinol--sucrose galactosyltransferase 2 isoform X1 [Vigna radiata var. radiata] Length = 754 Score = 59.7 bits (143), Expect = 3e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 306 EEEEFSYNPEDGLLTIKLDGEEGNSRDIEFVY 211 +EEEFSYNPEDGLLT KLDG EGNSRDIEFVY Sbjct: 724 KEEEFSYNPEDGLLTFKLDG-EGNSRDIEFVY 754 >KYP46630.1 putative glycosyltransferase At1g55740 family [Cajanus cajan] Length = 749 Score = 58.5 bits (140), Expect = 8e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 306 EEEEFSYNPEDGLLTIKLDGEEGNSRDIEFVY 211 +EEEFSYNPEDGLLTIKL G EGNSRDIEFVY Sbjct: 719 KEEEFSYNPEDGLLTIKLGG-EGNSRDIEFVY 749 >GAU40423.1 hypothetical protein TSUD_136700 [Trifolium subterraneum] Length = 749 Score = 53.5 bits (127), Expect = 5e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -2 Query: 309 EEEEEFSYNPEDGLLTIKLDGEEGNSRDIEFVY 211 + EEEFSYN EDGLLTI LDG +GNSRDIEFV+ Sbjct: 718 KNEEEFSYNSEDGLLTINLDG-DGNSRDIEFVF 749 >XP_013460983.1 raffinose synthase or seed inhibition protein [Medicago truncatula] KEH35017.1 raffinose synthase or seed inhibition protein [Medicago truncatula] Length = 751 Score = 53.1 bits (126), Expect = 7e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 306 EEEEFSYNPEDGLLTIKLDGEEGNSRDIEFVY 211 +EEEFSYN EDGL+ IKLDG EGNSRDIEFV+ Sbjct: 721 KEEEFSYNSEDGLVIIKLDG-EGNSRDIEFVF 751