BLASTX nr result
ID: Glycyrrhiza28_contig00030926
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00030926 (325 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004487490.1 PREDICTED: rho GTPase-activating protein 5 [Cicer... 64 2e-09 XP_003596831.1 PAK-box/P21-Rho-binding domain Rho GTPase activat... 55 1e-06 >XP_004487490.1 PREDICTED: rho GTPase-activating protein 5 [Cicer arietinum] Length = 450 Score = 63.5 bits (153), Expect = 2e-09 Identities = 39/79 (49%), Positives = 47/79 (59%), Gaps = 4/79 (5%) Frame = -2 Query: 324 ISSSENPVCKGDLYCEYPPXXXXXXXXXXXXXXXXXXXGPKK---KQHVIH-TMPVEKKG 157 IS+SENPVC DLYCE+PP G KK +QHVI+ + VEKKG Sbjct: 373 ISTSENPVCNEDLYCEFPPKRNMGKNKSGQSSSSNARKGSKKTRGQQHVINEKVLVEKKG 432 Query: 156 TRTMSARDTRSERIEAAWR 100 RT+S DTRS+R+E AWR Sbjct: 433 MRTLSNTDTRSDRVE-AWR 450 >XP_003596831.1 PAK-box/P21-Rho-binding domain Rho GTPase activating protein [Medicago truncatula] AES67082.1 PAK-box/P21-Rho-binding domain Rho GTPase activating protein [Medicago truncatula] Length = 451 Score = 55.5 bits (132), Expect = 1e-06 Identities = 34/80 (42%), Positives = 43/80 (53%), Gaps = 5/80 (6%) Frame = -2 Query: 324 ISSSENPVCKGDLYCEYPPXXXXXXXXXXXXXXXXXXXGPKKK----QHVIHTM-PVEKK 160 I +SENP+C +LYCE+PP KK Q VI+ VEKK Sbjct: 373 IRTSENPICNEELYCEFPPKKNMGKNNKSGQSSSSNARKGSKKTRGQQPVINGKGSVEKK 432 Query: 159 GTRTMSARDTRSERIEAAWR 100 G RT+S+ DTRS+R+E AWR Sbjct: 433 GMRTLSSTDTRSDRVE-AWR 451