BLASTX nr result
ID: Glycyrrhiza28_contig00030740
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00030740 (286 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004505723.1 PREDICTED: putative nitric oxide synthase [Cicer ... 54 2e-06 KYP68387.1 Uncharacterized protein yqeH [Cajanus cajan] 52 9e-06 >XP_004505723.1 PREDICTED: putative nitric oxide synthase [Cicer arietinum] Length = 595 Score = 53.9 bits (128), Expect = 2e-06 Identities = 28/39 (71%), Positives = 30/39 (76%), Gaps = 3/39 (7%) Frame = +2 Query: 179 MLVARNLSPSRLKPLFYLSLLSECKIHAQSN---PLKPD 286 M+VARN SPS+LKPLFYLSLLSECK QSN L PD Sbjct: 1 MIVARNFSPSKLKPLFYLSLLSECKSDVQSNLFITLTPD 39 >KYP68387.1 Uncharacterized protein yqeH [Cajanus cajan] Length = 593 Score = 52.4 bits (124), Expect = 9e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +2 Query: 179 MLVARNLSPSRLKPLFYLSLLSECKIHAQSN 271 MLVARNLSPS+LKPLFYLSLLSEC+ +SN Sbjct: 1 MLVARNLSPSKLKPLFYLSLLSECRSDYRSN 31