BLASTX nr result
ID: Glycyrrhiza28_contig00030727
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00030727 (411 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003530172.1 PREDICTED: B-box zinc finger protein 32-like [Gly... 54 4e-06 >XP_003530172.1 PREDICTED: B-box zinc finger protein 32-like [Glycine max] AEP17825.1 B-box 53 protein [Expression vector pMON98939] KRH47291.1 hypothetical protein GLYMA_07G020400 [Glycine max] Length = 243 Score = 54.3 bits (129), Expect = 4e-06 Identities = 32/56 (57%), Positives = 37/56 (66%), Gaps = 4/56 (7%) Frame = +1 Query: 184 ATPKEIKGRRRSCSSCMTDDVSPAAKRRKRNDGSAEAEVFAEWSRE----LRVNGN 339 A K + RR SS +TDD SPAAK+R+RN GS AEVF +WSRE L VNGN Sbjct: 106 AEKKRRRRRRSFSSSSVTDDASPAAKKRRRNGGSV-AEVFEKWSREIGLGLGVNGN 160