BLASTX nr result
ID: Glycyrrhiza28_contig00030567
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00030567 (377 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU42970.1 hypothetical protein TSUD_188430 [Trifolium subterran... 54 5e-06 >GAU42970.1 hypothetical protein TSUD_188430 [Trifolium subterraneum] Length = 767 Score = 54.3 bits (129), Expect = 5e-06 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -3 Query: 327 EGVNHFI*HGFFLRGKRFRKVTHIIWLAVVWPLWLMRNN*CDLSRMFNGPTL 172 +G NHF G L+ KRF KV H+IWLA W +W +RNN +FNG TL Sbjct: 677 DGWNHFNIFGSLLKTKRFEKVRHLIWLATTWSIWKLRNN-----VVFNGVTL 723