BLASTX nr result
ID: Glycyrrhiza28_contig00030194
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00030194 (246 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007148474.1 hypothetical protein PHAVU_006G211700g [Phaseolus... 60 8e-09 >XP_007148474.1 hypothetical protein PHAVU_006G211700g [Phaseolus vulgaris] ESW20468.1 hypothetical protein PHAVU_006G211700g [Phaseolus vulgaris] Length = 292 Score = 60.1 bits (144), Expect = 8e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 245 RLSNFIRLFLILVQKCPYSHFIETKISFCSRA 150 RLSNFIRLFLILVQKCPYSHFI+TKISF S A Sbjct: 260 RLSNFIRLFLILVQKCPYSHFIQTKISFYSCA 291