BLASTX nr result
ID: Glycyrrhiza28_contig00029762
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00029762 (279 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004487108.1 PREDICTED: putative pentatricopeptide repeat-cont... 64 7e-10 GAU30637.1 hypothetical protein TSUD_62570 [Trifolium subterraneum] 59 5e-08 OIW07967.1 hypothetical protein TanjilG_20068 [Lupinus angustifo... 55 9e-07 XP_019449620.1 PREDICTED: putative pentatricopeptide repeat-cont... 55 9e-07 >XP_004487108.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g08820 [Cicer arietinum] Length = 668 Score = 63.9 bits (154), Expect = 7e-10 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = -1 Query: 120 LELKKNLLVEGLKSLKQVKVAHCRLLRLSLHQDNYLLNIL 1 LELKK LVEGLKSLK VK+AHCRLLRL+L QDNYL NI+ Sbjct: 5 LELKKWCLVEGLKSLKDVKLAHCRLLRLNLQQDNYLPNII 44 >GAU30637.1 hypothetical protein TSUD_62570 [Trifolium subterraneum] Length = 369 Score = 58.5 bits (140), Expect = 5e-08 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -1 Query: 117 ELKKNLLVEGLKSLKQVKVAHCRLLRLSLHQDNYLLNIL 1 ELKK L EG KSLK VK+AHCRLLRL+L+ DN+LLNI+ Sbjct: 4 ELKKWCLAEGFKSLKHVKLAHCRLLRLNLNHDNHLLNII 42 >OIW07967.1 hypothetical protein TanjilG_20068 [Lupinus angustifolius] Length = 575 Score = 55.1 bits (131), Expect = 9e-07 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -1 Query: 120 LELKKNLLVEGLKSLKQVKVAHCRLLRLSLHQDNYLLNIL 1 LELKK LV+GL + Q+K AHCRLLRLSL QDNYL+NI+ Sbjct: 3 LELKK-FLVQGLTTFNQLKHAHCRLLRLSLDQDNYLINII 41 >XP_019449620.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g08820 [Lupinus angustifolius] Length = 675 Score = 55.1 bits (131), Expect = 9e-07 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -1 Query: 120 LELKKNLLVEGLKSLKQVKVAHCRLLRLSLHQDNYLLNIL 1 LELKK LV+GL + Q+K AHCRLLRLSL QDNYL+NI+ Sbjct: 3 LELKK-FLVQGLTTFNQLKHAHCRLLRLSLDQDNYLINII 41