BLASTX nr result
ID: Glycyrrhiza28_contig00029721
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00029721 (255 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CAN68981.1 hypothetical protein VITISV_004151 [Vitis vinifera] 80 1e-15 XP_015959174.1 PREDICTED: probable leucine-rich repeat receptor-... 80 1e-15 XP_015959173.1 PREDICTED: probable leucine-rich repeat receptor-... 80 1e-15 XP_016197654.1 PREDICTED: probable leucine-rich repeat receptor-... 80 1e-15 KRH36704.1 hypothetical protein GLYMA_09G018900 [Glycine max] 79 3e-15 KHN40741.1 Putative leucine-rich repeat receptor-like protein ki... 79 3e-15 XP_003535032.1 PREDICTED: probable leucine-rich repeat receptor-... 79 3e-15 XP_014518386.1 PREDICTED: probable leucine-rich repeat receptor-... 78 5e-15 XP_014518385.1 PREDICTED: probable leucine-rich repeat receptor-... 78 5e-15 XP_007147540.1 hypothetical protein PHAVU_006G133200g [Phaseolus... 78 5e-15 XP_014518384.1 PREDICTED: probable leucine-rich repeat receptor-... 78 5e-15 GAV77368.1 Pkinase domain-containing protein/LRR_1 domain-contai... 77 1e-14 XP_015940165.1 PREDICTED: probable leucine-rich repeat receptor-... 76 2e-14 XP_015940161.1 PREDICTED: probable leucine-rich repeat receptor-... 76 2e-14 XP_016195118.1 PREDICTED: probable leucine-rich repeat receptor-... 76 2e-14 XP_015940158.1 PREDICTED: probable leucine-rich repeat receptor-... 76 2e-14 XP_016195115.1 PREDICTED: probable leucine-rich repeat receptor-... 76 2e-14 KOM53215.1 hypothetical protein LR48_Vigan09g187400 [Vigna angul... 75 4e-14 XP_017437263.1 PREDICTED: probable leucine-rich repeat receptor-... 75 4e-14 XP_014518388.1 PREDICTED: probable leucine-rich repeat receptor-... 75 4e-14 >CAN68981.1 hypothetical protein VITISV_004151 [Vitis vinifera] Length = 763 Score = 80.1 bits (196), Expect = 1e-15 Identities = 38/51 (74%), Positives = 43/51 (84%) Frame = +3 Query: 102 NRLISRCSQVYRGTLPSGQMIAIKRAHKESKQGALEFKAEIELLSRVHHKN 254 N L+ CSQVYRG LP+GQM+AIKRA +ES QG LEFK E+ELLSRVHHKN Sbjct: 447 NILLLPCSQVYRGILPTGQMVAIKRAKQESMQGGLEFKTELELLSRVHHKN 497 >XP_015959174.1 PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g49770 isoform X2 [Arachis duranensis] Length = 941 Score = 79.7 bits (195), Expect = 1e-15 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = +3 Query: 126 QVYRGTLPSGQMIAIKRAHKESKQGALEFKAEIELLSRVHHKN 254 +VY+GTLPSGQ+IAIKRA KESKQG LEFKAEIELLSRVHHKN Sbjct: 626 KVYKGTLPSGQLIAIKRAQKESKQGGLEFKAEIELLSRVHHKN 668 >XP_015959173.1 PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g49770 isoform X1 [Arachis duranensis] Length = 943 Score = 79.7 bits (195), Expect = 1e-15 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = +3 Query: 126 QVYRGTLPSGQMIAIKRAHKESKQGALEFKAEIELLSRVHHKN 254 +VY+GTLPSGQ+IAIKRA KESKQG LEFKAEIELLSRVHHKN Sbjct: 628 KVYKGTLPSGQLIAIKRAQKESKQGGLEFKAEIELLSRVHHKN 670 >XP_016197654.1 PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g49770 [Arachis ipaensis] Length = 944 Score = 79.7 bits (195), Expect = 1e-15 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = +3 Query: 126 QVYRGTLPSGQMIAIKRAHKESKQGALEFKAEIELLSRVHHKN 254 +VY+GTLPSGQ+IAIKRA KESKQG LEFKAEIELLSRVHHKN Sbjct: 629 KVYKGTLPSGQLIAIKRAQKESKQGGLEFKAEIELLSRVHHKN 671 >KRH36704.1 hypothetical protein GLYMA_09G018900 [Glycine max] Length = 896 Score = 79.0 bits (193), Expect = 3e-15 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = +3 Query: 126 QVYRGTLPSGQMIAIKRAHKESKQGALEFKAEIELLSRVHHKN 254 +VYRGTLPSGQ++AIKRA +ESKQG LEFKAEIELLSRVHHKN Sbjct: 582 KVYRGTLPSGQVVAIKRAQRESKQGGLEFKAEIELLSRVHHKN 624 >KHN40741.1 Putative leucine-rich repeat receptor-like protein kinase [Glycine soja] Length = 945 Score = 79.0 bits (193), Expect = 3e-15 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = +3 Query: 126 QVYRGTLPSGQMIAIKRAHKESKQGALEFKAEIELLSRVHHKN 254 +VYRGTLPSGQ++AIKRA +ESKQG LEFKAEIELLSRVHHKN Sbjct: 631 KVYRGTLPSGQVVAIKRAQRESKQGGLEFKAEIELLSRVHHKN 673 >XP_003535032.1 PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g49770 [Glycine max] Length = 945 Score = 79.0 bits (193), Expect = 3e-15 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = +3 Query: 126 QVYRGTLPSGQMIAIKRAHKESKQGALEFKAEIELLSRVHHKN 254 +VYRGTLPSGQ++AIKRA +ESKQG LEFKAEIELLSRVHHKN Sbjct: 631 KVYRGTLPSGQVVAIKRAQRESKQGGLEFKAEIELLSRVHHKN 673 >XP_014518386.1 PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g49770 isoform X3 [Vigna radiata var. radiata] Length = 797 Score = 78.2 bits (191), Expect = 5e-15 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = +3 Query: 126 QVYRGTLPSGQMIAIKRAHKESKQGALEFKAEIELLSRVHHKN 254 +VYRGTLP+GQ++AIKRA KESKQGA EFKAEIELLSRVHHKN Sbjct: 633 KVYRGTLPTGQVVAIKRAQKESKQGAQEFKAEIELLSRVHHKN 675 >XP_014518385.1 PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g49770 isoform X2 [Vigna radiata var. radiata] Length = 934 Score = 78.2 bits (191), Expect = 5e-15 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = +3 Query: 126 QVYRGTLPSGQMIAIKRAHKESKQGALEFKAEIELLSRVHHKN 254 +VYRGTLP+GQ++AIKRA KESKQGA EFKAEIELLSRVHHKN Sbjct: 620 KVYRGTLPTGQVVAIKRAQKESKQGAQEFKAEIELLSRVHHKN 662 >XP_007147540.1 hypothetical protein PHAVU_006G133200g [Phaseolus vulgaris] ESW19534.1 hypothetical protein PHAVU_006G133200g [Phaseolus vulgaris] Length = 944 Score = 78.2 bits (191), Expect = 5e-15 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = +3 Query: 126 QVYRGTLPSGQMIAIKRAHKESKQGALEFKAEIELLSRVHHKN 254 +VYRGTLP+GQ++AIKRA KESKQGA EFKAEIELLSRVHHKN Sbjct: 631 KVYRGTLPTGQVVAIKRAQKESKQGAQEFKAEIELLSRVHHKN 673 >XP_014518384.1 PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g49770 isoform X1 [Vigna radiata var. radiata] Length = 946 Score = 78.2 bits (191), Expect = 5e-15 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = +3 Query: 126 QVYRGTLPSGQMIAIKRAHKESKQGALEFKAEIELLSRVHHKN 254 +VYRGTLP+GQ++AIKRA KESKQGA EFKAEIELLSRVHHKN Sbjct: 632 KVYRGTLPTGQVVAIKRAQKESKQGAQEFKAEIELLSRVHHKN 674 >GAV77368.1 Pkinase domain-containing protein/LRR_1 domain-containing protein [Cephalotus follicularis] Length = 956 Score = 77.0 bits (188), Expect = 1e-14 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = +3 Query: 126 QVYRGTLPSGQMIAIKRAHKESKQGALEFKAEIELLSRVHHKN 254 +VYRGTLPSGQ+IAIKRA +ES QGALEFK EIELLSRVHHKN Sbjct: 645 KVYRGTLPSGQLIAIKRAQQESMQGALEFKTEIELLSRVHHKN 687 >XP_015940165.1 PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g49770 isoform X3 [Arachis duranensis] Length = 913 Score = 76.3 bits (186), Expect = 2e-14 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +3 Query: 126 QVYRGTLPSGQMIAIKRAHKESKQGALEFKAEIELLSRVHHKN 254 +VY+GTLP+GQ++AIKRA +ESKQG LEFKAEIELLSRVHHKN Sbjct: 596 KVYKGTLPNGQLLAIKRAQRESKQGRLEFKAEIELLSRVHHKN 638 >XP_015940161.1 PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g49770 isoform X2 [Arachis duranensis] Length = 937 Score = 76.3 bits (186), Expect = 2e-14 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +3 Query: 126 QVYRGTLPSGQMIAIKRAHKESKQGALEFKAEIELLSRVHHKN 254 +VY+GTLP+GQ++AIKRA +ESKQG LEFKAEIELLSRVHHKN Sbjct: 620 KVYKGTLPNGQLLAIKRAQRESKQGRLEFKAEIELLSRVHHKN 662 >XP_016195118.1 PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g49770 isoform X2 [Arachis ipaensis] Length = 939 Score = 76.3 bits (186), Expect = 2e-14 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +3 Query: 126 QVYRGTLPSGQMIAIKRAHKESKQGALEFKAEIELLSRVHHKN 254 +VY+GTLP+GQ++AIKRA +ESKQG LEFKAEIELLSRVHHKN Sbjct: 622 KVYKGTLPNGQLLAIKRAQRESKQGRLEFKAEIELLSRVHHKN 664 >XP_015940158.1 PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g49770 isoform X1 [Arachis duranensis] Length = 962 Score = 76.3 bits (186), Expect = 2e-14 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +3 Query: 126 QVYRGTLPSGQMIAIKRAHKESKQGALEFKAEIELLSRVHHKN 254 +VY+GTLP+GQ++AIKRA +ESKQG LEFKAEIELLSRVHHKN Sbjct: 645 KVYKGTLPNGQLLAIKRAQRESKQGRLEFKAEIELLSRVHHKN 687 >XP_016195115.1 PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g49770 isoform X1 [Arachis ipaensis] Length = 964 Score = 76.3 bits (186), Expect = 2e-14 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +3 Query: 126 QVYRGTLPSGQMIAIKRAHKESKQGALEFKAEIELLSRVHHKN 254 +VY+GTLP+GQ++AIKRA +ESKQG LEFKAEIELLSRVHHKN Sbjct: 647 KVYKGTLPNGQLLAIKRAQRESKQGRLEFKAEIELLSRVHHKN 689 >KOM53215.1 hypothetical protein LR48_Vigan09g187400 [Vigna angularis] Length = 895 Score = 75.5 bits (184), Expect = 4e-14 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = +3 Query: 126 QVYRGTLPSGQMIAIKRAHKESKQGALEFKAEIELLSRVHHKN 254 +VYRGTLP+GQ+IA+KRA KES QG LEFK EIELLSRVHHKN Sbjct: 590 KVYRGTLPNGQLIAVKRAQKESMQGGLEFKTEIELLSRVHHKN 632 >XP_017437263.1 PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g49770 [Vigna angularis] Length = 920 Score = 75.5 bits (184), Expect = 4e-14 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = +3 Query: 126 QVYRGTLPSGQMIAIKRAHKESKQGALEFKAEIELLSRVHHKN 254 +VYRGTLP+GQ+IA+KRA KES QG LEFK EIELLSRVHHKN Sbjct: 615 KVYRGTLPNGQLIAVKRAQKESMQGGLEFKTEIELLSRVHHKN 657 >XP_014518388.1 PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g49770 [Vigna radiata var. radiata] Length = 920 Score = 75.5 bits (184), Expect = 4e-14 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = +3 Query: 126 QVYRGTLPSGQMIAIKRAHKESKQGALEFKAEIELLSRVHHKN 254 +VYRGTLP+GQ+IA+KRA KES QG LEFK EIELLSRVHHKN Sbjct: 615 KVYRGTLPNGQLIAVKRAQKESMQGGLEFKTEIELLSRVHHKN 657