BLASTX nr result
ID: Glycyrrhiza28_contig00029691
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00029691 (264 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019454483.1 PREDICTED: probable inactive purple acid phosphat... 52 9e-06 OIW04709.1 hypothetical protein TanjilG_07834 [Lupinus angustifo... 52 9e-06 >XP_019454483.1 PREDICTED: probable inactive purple acid phosphatase 1 [Lupinus angustifolius] Length = 619 Score = 52.0 bits (123), Expect = 9e-06 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = +2 Query: 140 IISSKTEMGESKFVFLALFLLVCSVLQRVVKSHGDQPLSKV 262 ++ KT+MG+SKFVFL +LLVCSVLQ +V SHGD PLSKV Sbjct: 1 MLKQKTKMGDSKFVFLG-YLLVCSVLQ-LVWSHGDHPLSKV 39 >OIW04709.1 hypothetical protein TanjilG_07834 [Lupinus angustifolius] Length = 643 Score = 52.0 bits (123), Expect = 9e-06 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = +2 Query: 140 IISSKTEMGESKFVFLALFLLVCSVLQRVVKSHGDQPLSKV 262 ++ KT+MG+SKFVFL +LLVCSVLQ +V SHGD PLSKV Sbjct: 1 MLKQKTKMGDSKFVFLG-YLLVCSVLQ-LVWSHGDHPLSKV 39