BLASTX nr result
ID: Glycyrrhiza28_contig00029670
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00029670 (497 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003620488.2 P-loop nucleoside triphosphate hydrolase superfam... 64 5e-09 >XP_003620488.2 P-loop nucleoside triphosphate hydrolase superfamily protein [Medicago truncatula] AES76706.2 P-loop nucleoside triphosphate hydrolase superfamily protein [Medicago truncatula] Length = 854 Score = 64.3 bits (155), Expect = 5e-09 Identities = 31/54 (57%), Positives = 40/54 (74%) Frame = +3 Query: 3 SSRKSSLPYNIGVQIIEIHNDELRDMLSIGVSPK*YPFYHSYRHFILCTNFFFL 164 SSR+SS+ Y IGVQIIEI+N+++RD+LS S K YPF+ SY FI+C F L Sbjct: 596 SSRQSSIVYEIGVQIIEIYNEQVRDLLSTDTSVKKYPFFSSYIWFIMCMGFLQL 649