BLASTX nr result
ID: Glycyrrhiza28_contig00029587
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00029587 (269 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_024579491.1 MULTISPECIES: TIGR03809 family protein [Bradyrhiz... 64 9e-11 WP_050403319.1 TIGR03809 family protein [Bradyrhizobium embrapense] 60 3e-09 WP_038387169.1 TIGR03809 family protein [Bradyrhizobium elkanii] 59 5e-09 WP_028345365.1 TIGR03809 family protein [Bradyrhizobium elkanii] 59 5e-09 WP_016843224.1 TIGR03809 family protein [Bradyrhizobium elkanii]... 59 5e-09 WP_028331656.1 MULTISPECIES: TIGR03809 family protein [Bradyrhiz... 57 4e-08 SEE42469.1 TIGR03809 family protein [Bradyrhizobium erythrophlei] 55 1e-07 WP_050626248.1 TIGR03809 family protein [Bradyrhizobium viridifu... 55 2e-07 WP_076862362.1 TIGR03809 family protein [Bradyrhizobium sp. SEMI... 55 2e-07 WP_029082089.1 TIGR03809 family protein [Bradyrhizobium sp. th.b2] 55 3e-07 SDC46519.1 TIGR03809 family protein [Bradyrhizobium sp. R5] 54 6e-07 ERF80579.1 dihydropyrimidinase [Bradyrhizobium sp. DFCI-1] 53 2e-06 WP_076833120.1 TIGR03809 family protein [Bradyrhizobium sp. UFLA... 52 2e-06 WP_074131313.1 TIGR03809 family protein [Bradyrhizobium sp. NAS9... 52 2e-06 >WP_024579491.1 MULTISPECIES: TIGR03809 family protein [Bradyrhizobium] KIU45240.1 hypothetical protein QU41_25020 [Bradyrhizobium elkanii] OCX30225.1 TIGR03809 family protein [Bradyrhizobium sp. UASWS1016] Length = 163 Score = 63.9 bits (154), Expect = 9e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 3 PLEMPPPARPPVLDLDTIQRRYPLLRNAL 89 PLEMPPPARPPVLDLDTIQRRYPLLRNAL Sbjct: 135 PLEMPPPARPPVLDLDTIQRRYPLLRNAL 163 >WP_050403319.1 TIGR03809 family protein [Bradyrhizobium embrapense] Length = 167 Score = 60.1 bits (144), Expect = 3e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +3 Query: 3 PLEMPPPARPPVLDLDTIQRRYPLLRNAL 89 PLEMPPP PPVLDLDTIQRRYPLLRNAL Sbjct: 139 PLEMPPPVTPPVLDLDTIQRRYPLLRNAL 167 >WP_038387169.1 TIGR03809 family protein [Bradyrhizobium elkanii] Length = 164 Score = 59.3 bits (142), Expect = 5e-09 Identities = 29/30 (96%), Positives = 29/30 (96%), Gaps = 1/30 (3%) Frame = +3 Query: 3 PLEMPPPA-RPPVLDLDTIQRRYPLLRNAL 89 PLEMPPPA RPPVLDLDTIQRRYPLLRNAL Sbjct: 135 PLEMPPPAVRPPVLDLDTIQRRYPLLRNAL 164 >WP_028345365.1 TIGR03809 family protein [Bradyrhizobium elkanii] Length = 164 Score = 59.3 bits (142), Expect = 5e-09 Identities = 29/30 (96%), Positives = 29/30 (96%), Gaps = 1/30 (3%) Frame = +3 Query: 3 PLEMPPPA-RPPVLDLDTIQRRYPLLRNAL 89 PLEMPPPA RPPVLDLDTIQRRYPLLRNAL Sbjct: 135 PLEMPPPAVRPPVLDLDTIQRRYPLLRNAL 164 >WP_016843224.1 TIGR03809 family protein [Bradyrhizobium elkanii] ODM72436.1 hypothetical protein A6452_04855 [Bradyrhizobium elkanii] ODM83528.1 hypothetical protein A6X20_15700 [Bradyrhizobium elkanii] Length = 164 Score = 59.3 bits (142), Expect = 5e-09 Identities = 29/30 (96%), Positives = 29/30 (96%), Gaps = 1/30 (3%) Frame = +3 Query: 3 PLEMPPPA-RPPVLDLDTIQRRYPLLRNAL 89 PLEMPPPA RPPVLDLDTIQRRYPLLRNAL Sbjct: 135 PLEMPPPAVRPPVLDLDTIQRRYPLLRNAL 164 >WP_028331656.1 MULTISPECIES: TIGR03809 family protein [Bradyrhizobium] Length = 164 Score = 57.0 bits (136), Expect = 4e-08 Identities = 28/30 (93%), Positives = 28/30 (93%), Gaps = 1/30 (3%) Frame = +3 Query: 3 PLEMPPPARPP-VLDLDTIQRRYPLLRNAL 89 PLEMPPPA PP VLDLDTIQRRYPLLRNAL Sbjct: 135 PLEMPPPAMPPPVLDLDTIQRRYPLLRNAL 164 >SEE42469.1 TIGR03809 family protein [Bradyrhizobium erythrophlei] Length = 159 Score = 55.5 bits (132), Expect = 1e-07 Identities = 27/30 (90%), Positives = 27/30 (90%), Gaps = 1/30 (3%) Frame = +3 Query: 3 PLEMPPPARPP-VLDLDTIQRRYPLLRNAL 89 PLEMPPP PP VLDLDTIQRRYPLLRNAL Sbjct: 130 PLEMPPPVMPPPVLDLDTIQRRYPLLRNAL 159 >WP_050626248.1 TIGR03809 family protein [Bradyrhizobium viridifuturi] Length = 164 Score = 55.5 bits (132), Expect = 2e-07 Identities = 27/30 (90%), Positives = 27/30 (90%), Gaps = 1/30 (3%) Frame = +3 Query: 3 PLEMPPPARPP-VLDLDTIQRRYPLLRNAL 89 PLEMPPP PP VLDLDTIQRRYPLLRNAL Sbjct: 135 PLEMPPPVMPPPVLDLDTIQRRYPLLRNAL 164 >WP_076862362.1 TIGR03809 family protein [Bradyrhizobium sp. SEMIA 6399] Length = 169 Score = 55.1 bits (131), Expect = 2e-07 Identities = 28/35 (80%), Positives = 28/35 (80%), Gaps = 6/35 (17%) Frame = +3 Query: 3 PLEMPPPARPP------VLDLDTIQRRYPLLRNAL 89 PLEMPPPA PP VLDLDTIQRRYPLLRNAL Sbjct: 135 PLEMPPPAMPPQVMPPPVLDLDTIQRRYPLLRNAL 169 >WP_029082089.1 TIGR03809 family protein [Bradyrhizobium sp. th.b2] Length = 170 Score = 54.7 bits (130), Expect = 3e-07 Identities = 27/30 (90%), Positives = 27/30 (90%), Gaps = 1/30 (3%) Frame = +3 Query: 3 PLEMPPPA-RPPVLDLDTIQRRYPLLRNAL 89 PLEMP P RPPVLDLDTIQRRYPLLRNAL Sbjct: 141 PLEMPQPVLRPPVLDLDTIQRRYPLLRNAL 170 >SDC46519.1 TIGR03809 family protein [Bradyrhizobium sp. R5] Length = 158 Score = 53.9 bits (128), Expect = 6e-07 Identities = 27/30 (90%), Positives = 27/30 (90%), Gaps = 1/30 (3%) Frame = +3 Query: 3 PLEMPPPARPP-VLDLDTIQRRYPLLRNAL 89 PLEMP PA PP VLDLDTIQRRYPLLRNAL Sbjct: 129 PLEMPAPAAPPPVLDLDTIQRRYPLLRNAL 158 >ERF80579.1 dihydropyrimidinase [Bradyrhizobium sp. DFCI-1] Length = 164 Score = 52.8 bits (125), Expect = 2e-06 Identities = 26/29 (89%), Positives = 26/29 (89%), Gaps = 1/29 (3%) Frame = +3 Query: 6 LEMPPPARPP-VLDLDTIQRRYPLLRNAL 89 LEMPPP PP VLDLDTIQRRYPLLRNAL Sbjct: 136 LEMPPPVMPPPVLDLDTIQRRYPLLRNAL 164 >WP_076833120.1 TIGR03809 family protein [Bradyrhizobium sp. UFLA 03-321] OMI01119.1 TIGR03809 family protein [Bradyrhizobium sp. UFLA 03-321] Length = 164 Score = 52.4 bits (124), Expect = 2e-06 Identities = 26/30 (86%), Positives = 26/30 (86%), Gaps = 1/30 (3%) Frame = +3 Query: 3 PLEMPPPARPP-VLDLDTIQRRYPLLRNAL 89 PLEMP PA PP VLDLDTIQRRYPLLRN L Sbjct: 135 PLEMPAPAAPPPVLDLDTIQRRYPLLRNTL 164 >WP_074131313.1 TIGR03809 family protein [Bradyrhizobium sp. NAS96.2] OKO68992.1 hypothetical protein AC628_34535 [Bradyrhizobium sp. NAS96.2] Length = 164 Score = 52.4 bits (124), Expect = 2e-06 Identities = 26/30 (86%), Positives = 26/30 (86%), Gaps = 1/30 (3%) Frame = +3 Query: 3 PLEMPPPARPP-VLDLDTIQRRYPLLRNAL 89 PLEMPP PP VLDLDTIQRRYPLLRNAL Sbjct: 135 PLEMPPAVMPPPVLDLDTIQRRYPLLRNAL 164