BLASTX nr result
ID: Glycyrrhiza28_contig00029533
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00029533 (444 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN07014.1 Pentatricopeptide repeat-containing protein, chloropl... 57 8e-07 XP_003527773.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 4e-06 KOM42073.1 hypothetical protein LR48_Vigan04g227100 [Vigna angul... 55 7e-06 XP_017422433.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 7e-06 >KHN07014.1 Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 1113 Score = 57.4 bits (137), Expect = 8e-07 Identities = 32/63 (50%), Positives = 35/63 (55%) Frame = -2 Query: 191 MAVLVLXXXXXXXXXXXXXCALTGINFYVLSKNGFLGETNFVKMKTLSKGSLGNWKKRGK 12 MAVLVL CA +G N YV+S NGF GET FVKMK+ GS WKK GK Sbjct: 1 MAVLVLCSSTICSSSLSSCCAFSGTNVYVMSNNGFFGETPFVKMKSFPNGSSVIWKKHGK 60 Query: 11 SHL 3 L Sbjct: 61 RQL 63 >XP_003527773.1 PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic [Glycine max] KRH52317.1 hypothetical protein GLYMA_06G061000 [Glycine max] Length = 1113 Score = 55.5 bits (132), Expect = 4e-06 Identities = 31/63 (49%), Positives = 34/63 (53%) Frame = -2 Query: 191 MAVLVLXXXXXXXXXXXXXCALTGINFYVLSKNGFLGETNFVKMKTLSKGSLGNWKKRGK 12 MAVLVL CA +G N YV+S NGF GET F KMK+ GS WKK GK Sbjct: 1 MAVLVLCSSTICSSSLSSCCAFSGTNVYVMSNNGFFGETPFFKMKSFPNGSSVIWKKHGK 60 Query: 11 SHL 3 L Sbjct: 61 RQL 63 >KOM42073.1 hypothetical protein LR48_Vigan04g227100 [Vigna angularis] Length = 1102 Score = 54.7 bits (130), Expect = 7e-06 Identities = 27/43 (62%), Positives = 28/43 (65%) Frame = -2 Query: 131 ALTGINFYVLSKNGFLGETNFVKMKTLSKGSLGNWKKRGKSHL 3 AL N Y LS NGF G T FVKMK+L GSL NWKK GK L Sbjct: 14 ALGDTNVYALSNNGFFGGTPFVKMKSLPNGSLVNWKKHGKRQL 56 >XP_017422433.1 PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic [Vigna angularis] BAT78072.1 hypothetical protein VIGAN_02070900 [Vigna angularis var. angularis] Length = 1106 Score = 54.7 bits (130), Expect = 7e-06 Identities = 27/43 (62%), Positives = 28/43 (65%) Frame = -2 Query: 131 ALTGINFYVLSKNGFLGETNFVKMKTLSKGSLGNWKKRGKSHL 3 AL N Y LS NGF G T FVKMK+L GSL NWKK GK L Sbjct: 14 ALGDTNVYALSNNGFFGGTPFVKMKSLPNGSLVNWKKHGKRQL 56