BLASTX nr result
ID: Glycyrrhiza28_contig00029532
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00029532 (284 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019457241.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 8e-08 >XP_019457241.1 PREDICTED: pentatricopeptide repeat-containing protein DOT4, chloroplastic-like [Lupinus angustifolius] Length = 666 Score = 58.2 bits (139), Expect = 8e-08 Identities = 35/81 (43%), Positives = 43/81 (53%), Gaps = 3/81 (3%) Frame = -3 Query: 282 TNSFVHPLPLRYLRSTATTSSAPISLTNNNQTHKVFDESP---QLAWNTLIHTHLANNNL 112 TN+ L + + +A SLT+ TH +FDE P AWNTLI THL NN+ Sbjct: 22 TNTIFMQLGHHQYHNASRIDNASTSLTH---THHLFDEIPLWDTFAWNTLIQTHLTNNDF 78 Query: 111 PLALSTLTQMLHLGFPLDTYT 49 LST QML G PLD +T Sbjct: 79 THVLSTYIQMLQRGVPLDKHT 99