BLASTX nr result
ID: Glycyrrhiza28_contig00028943
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00028943 (203 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_008797455.1 PREDICTED: DNA-directed RNA polymerases II, IV an... 72 9e-15 AFK35454.1 unknown [Lotus japonicus] AFK40167.1 unknown [Lotus j... 71 3e-14 JAT61781.1 DNA-directed RNA polymerase II subunit RPB9 [Anthuriu... 70 4e-14 XP_015959557.1 PREDICTED: DNA-directed RNA polymerases II, IV an... 70 4e-14 XP_002276956.1 PREDICTED: DNA-directed RNA polymerases II, IV an... 70 4e-14 XP_012453290.1 PREDICTED: DNA-directed RNA polymerases II, IV an... 70 4e-14 XP_010921503.1 PREDICTED: DNA-directed RNA polymerases II, IV an... 70 4e-14 XP_009419902.1 PREDICTED: DNA-directed RNA polymerases II, IV an... 70 4e-14 XP_007035762.1 PREDICTED: DNA-directed RNA polymerases II, IV an... 70 4e-14 XP_020101418.1 DNA-directed RNA polymerases II, IV and V subunit... 70 5e-14 OAY56101.1 hypothetical protein MANES_03G202800 [Manihot esculenta] 70 5e-14 XP_009407989.1 PREDICTED: DNA-directed RNA polymerases II, IV an... 70 5e-14 NP_001150634.1 uncharacterized protein LOC100284267 [Zea mays] A... 70 5e-14 XP_004962772.1 PREDICTED: DNA-directed RNA polymerases II, IV an... 70 5e-14 XP_002443356.1 hypothetical protein SORBIDRAFT_08g018130 [Sorghu... 70 5e-14 OAP06559.1 NRPE9A [Arabidopsis thaliana] 69 5e-14 XP_009407987.1 PREDICTED: DNA-directed RNA polymerases II, IV an... 70 7e-14 ONK63193.1 uncharacterized protein A4U43_C07F12360 [Asparagus of... 69 1e-13 OAY69748.1 DNA-directed RNA polymerases II, IV and V subunit 9A ... 69 1e-13 KYP35902.1 DNA-directed RNA polymerase II subunit RPB9 [Cajanus ... 69 1e-13 >XP_008797455.1 PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 9A-like [Phoenix dactylifera] Length = 114 Score = 72.0 bits (175), Expect = 9e-15 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 107 CPECNNILYPKEDREKKILLYACRNCDHQEVA 202 C ECNNILYPKEDREKKILLYACRNCDHQEVA Sbjct: 7 CRECNNILYPKEDREKKILLYACRNCDHQEVA 38 >AFK35454.1 unknown [Lotus japonicus] AFK40167.1 unknown [Lotus japonicus] Length = 118 Score = 70.9 bits (172), Expect = 3e-14 Identities = 33/41 (80%), Positives = 39/41 (95%) Frame = -2 Query: 202 SDLLVIAVAASVEKNLLLSIFFRVENVVAFGAKFHGTHLGR 80 S+LLVI +AASVE+NLL+S+FFRV+NVVAF AKFHGTHLGR Sbjct: 73 SNLLVITIAASVEENLLVSVFFRVQNVVAFAAKFHGTHLGR 113 >JAT61781.1 DNA-directed RNA polymerase II subunit RPB9 [Anthurium amnicola] Length = 114 Score = 70.5 bits (171), Expect = 4e-14 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +2 Query: 107 CPECNNILYPKEDREKKILLYACRNCDHQEVA 202 C ECNNILYPKEDRE+KILLYACRNCDHQEVA Sbjct: 7 CRECNNILYPKEDREQKILLYACRNCDHQEVA 38 >XP_015959557.1 PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 9A [Arachis duranensis] XP_016197887.1 PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 9A [Arachis ipaensis] Length = 114 Score = 70.5 bits (171), Expect = 4e-14 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +2 Query: 107 CPECNNILYPKEDREKKILLYACRNCDHQEVA 202 C ECNNILYPKEDRE+KILLYACRNCDHQEVA Sbjct: 7 CRECNNILYPKEDREQKILLYACRNCDHQEVA 38 >XP_002276956.1 PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 9A [Vitis vinifera] CAN66735.1 hypothetical protein VITISV_024186 [Vitis vinifera] CBI22899.3 unnamed protein product, partial [Vitis vinifera] Length = 114 Score = 70.5 bits (171), Expect = 4e-14 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +2 Query: 107 CPECNNILYPKEDREKKILLYACRNCDHQEVA 202 C ECNNILYPKEDRE+KILLYACRNCDHQEVA Sbjct: 7 CRECNNILYPKEDREQKILLYACRNCDHQEVA 38 >XP_012453290.1 PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 9A [Gossypium raimondii] XP_016724235.1 PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 9A [Gossypium hirsutum] XP_017640653.1 PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 9A [Gossypium arboreum] KJB12663.1 hypothetical protein B456_002G030000 [Gossypium raimondii] Length = 114 Score = 70.5 bits (171), Expect = 4e-14 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +2 Query: 107 CPECNNILYPKEDREKKILLYACRNCDHQEVA 202 C ECNNILYPKEDRE+KILLYACRNCDHQEVA Sbjct: 7 CRECNNILYPKEDREQKILLYACRNCDHQEVA 38 >XP_010921503.1 PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 9A [Elaeis guineensis] Length = 114 Score = 70.5 bits (171), Expect = 4e-14 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +2 Query: 107 CPECNNILYPKEDREKKILLYACRNCDHQEVA 202 C ECNNILYPKEDRE+KILLYACRNCDHQEVA Sbjct: 7 CRECNNILYPKEDREQKILLYACRNCDHQEVA 38 >XP_009419902.1 PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 9A [Musa acuminata subsp. malaccensis] Length = 114 Score = 70.5 bits (171), Expect = 4e-14 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +2 Query: 107 CPECNNILYPKEDREKKILLYACRNCDHQEVA 202 C ECNNILYPKEDRE+KILLYACRNCDHQEVA Sbjct: 7 CRECNNILYPKEDREQKILLYACRNCDHQEVA 38 >XP_007035762.1 PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 9A [Theobroma cacao] EOY06688.1 RNA polymerases M/15 Kd subunit [Theobroma cacao] Length = 114 Score = 70.5 bits (171), Expect = 4e-14 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +2 Query: 107 CPECNNILYPKEDREKKILLYACRNCDHQEVA 202 C ECNNILYPKEDRE+KILLYACRNCDHQEVA Sbjct: 7 CRECNNILYPKEDREQKILLYACRNCDHQEVA 38 >XP_020101418.1 DNA-directed RNA polymerases II, IV and V subunit 9B [Ananas comosus] OAY69137.1 DNA-directed RNA polymerases II, IV and V subunit 9B [Ananas comosus] Length = 114 Score = 70.1 bits (170), Expect = 5e-14 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 107 CPECNNILYPKEDREKKILLYACRNCDHQEVA 202 C ECNNILYPKEDRE+K+LLYACRNCDHQEVA Sbjct: 7 CRECNNILYPKEDREQKVLLYACRNCDHQEVA 38 >OAY56101.1 hypothetical protein MANES_03G202800 [Manihot esculenta] Length = 114 Score = 70.1 bits (170), Expect = 5e-14 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = +2 Query: 107 CPECNNILYPKEDREKKILLYACRNCDHQEVA 202 CP+CNNILYPKEDR+++ILLYACRNCDHQEVA Sbjct: 7 CPDCNNILYPKEDRKQRILLYACRNCDHQEVA 38 >XP_009407989.1 PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 9A-like isoform X3 [Musa acuminata subsp. malaccensis] Length = 114 Score = 70.1 bits (170), Expect = 5e-14 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 107 CPECNNILYPKEDREKKILLYACRNCDHQEVA 202 C ECNNILYPKEDRE+K+LLYACRNCDHQEVA Sbjct: 7 CRECNNILYPKEDREQKVLLYACRNCDHQEVA 38 >NP_001150634.1 uncharacterized protein LOC100284267 [Zea mays] ACG39846.1 DNA-directed RNA polymerase II 14.5 kDa polypeptide [Zea mays] ONM33369.1 DNA-directed RNA polymerase subunit [Zea mays] Length = 114 Score = 70.1 bits (170), Expect = 5e-14 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 107 CPECNNILYPKEDREKKILLYACRNCDHQEVA 202 C ECNNILYPKEDRE+K+LLYACRNCDHQEVA Sbjct: 7 CRECNNILYPKEDREQKVLLYACRNCDHQEVA 38 >XP_004962772.1 PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 9B-like [Setaria italica] KQL16610.1 hypothetical protein SETIT_023680mg [Setaria italica] Length = 114 Score = 70.1 bits (170), Expect = 5e-14 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 107 CPECNNILYPKEDREKKILLYACRNCDHQEVA 202 C ECNNILYPKEDRE+K+LLYACRNCDHQEVA Sbjct: 7 CRECNNILYPKEDREQKVLLYACRNCDHQEVA 38 >XP_002443356.1 hypothetical protein SORBIDRAFT_08g018130 [Sorghum bicolor] EES17194.1 hypothetical protein SORBI_008G128900 [Sorghum bicolor] Length = 114 Score = 70.1 bits (170), Expect = 5e-14 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 107 CPECNNILYPKEDREKKILLYACRNCDHQEVA 202 C ECNNILYPKEDRE+K+LLYACRNCDHQEVA Sbjct: 7 CRECNNILYPKEDREQKVLLYACRNCDHQEVA 38 >OAP06559.1 NRPE9A [Arabidopsis thaliana] Length = 89 Score = 69.3 bits (168), Expect = 5e-14 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 107 CPECNNILYPKEDREKKILLYACRNCDHQEVA 202 C ECNNILYPKED+E+KILLYACRNCDHQEVA Sbjct: 7 CRECNNILYPKEDKEQKILLYACRNCDHQEVA 38 >XP_009407987.1 PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 9A-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 125 Score = 70.1 bits (170), Expect = 7e-14 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 107 CPECNNILYPKEDREKKILLYACRNCDHQEVA 202 C ECNNILYPKEDRE+K+LLYACRNCDHQEVA Sbjct: 7 CRECNNILYPKEDREQKVLLYACRNCDHQEVA 38 >ONK63193.1 uncharacterized protein A4U43_C07F12360 [Asparagus officinalis] Length = 114 Score = 69.3 bits (168), Expect = 1e-13 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 107 CPECNNILYPKEDREKKILLYACRNCDHQEVA 202 C ECNNILYPKEDR++KILLYACRNCDHQEVA Sbjct: 7 CRECNNILYPKEDRDQKILLYACRNCDHQEVA 38 >OAY69748.1 DNA-directed RNA polymerases II, IV and V subunit 9A [Ananas comosus] Length = 114 Score = 69.3 bits (168), Expect = 1e-13 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 107 CPECNNILYPKEDREKKILLYACRNCDHQEVA 202 C ECNNILYPKEDRE+KILLYACRNCDHQEV+ Sbjct: 7 CRECNNILYPKEDREQKILLYACRNCDHQEVS 38 >KYP35902.1 DNA-directed RNA polymerase II subunit RPB9 [Cajanus cajan] Length = 114 Score = 69.3 bits (168), Expect = 1e-13 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 107 CPECNNILYPKEDREKKILLYACRNCDHQEVA 202 C ECNNILYPKEDR++KILLYACRNCDHQEVA Sbjct: 7 CRECNNILYPKEDRDQKILLYACRNCDHQEVA 38