BLASTX nr result
ID: Glycyrrhiza28_contig00028894
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00028894 (512 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN29973.1 Serine/threonine-protein kinase dst1 [Glycine soja] 109 1e-24 XP_003517847.1 PREDICTED: serine/threonine-protein kinase dst1-l... 109 1e-24 XP_006573156.1 PREDICTED: serine/threonine-protein kinase dst1-l... 109 1e-24 KOM45858.1 hypothetical protein LR48_Vigan06g116400 [Vigna angul... 109 1e-24 XP_016188519.1 PREDICTED: serine/threonine-protein kinase dst2 i... 109 1e-24 XP_016188518.1 PREDICTED: serine/threonine-protein kinase dst2 i... 109 1e-24 XP_016188517.1 PREDICTED: serine/threonine-protein kinase dst2 i... 109 1e-24 XP_016188516.1 PREDICTED: serine/threonine-protein kinase dst2 i... 109 1e-24 XP_016188514.1 PREDICTED: serine/threonine-protein kinase dst2 i... 109 1e-24 XP_015953628.1 PREDICTED: serine/threonine-protein kinase dst2 i... 109 1e-24 XP_015953627.1 PREDICTED: serine/threonine-protein kinase dst2 i... 109 1e-24 XP_015953626.1 PREDICTED: serine/threonine-protein kinase dst2 i... 109 1e-24 XP_015953625.1 PREDICTED: serine/threonine-protein kinase dst2 i... 109 1e-24 XP_015953624.1 PREDICTED: serine/threonine-protein kinase dst2 i... 109 1e-24 KYP65718.1 Serine/threonine-protein kinase dst1, partial [Cajanu... 109 1e-24 XP_015953622.1 PREDICTED: serine/threonine-protein kinase dst2 i... 109 1e-24 XP_007153500.1 hypothetical protein PHAVU_003G041000g [Phaseolus... 109 1e-24 XP_017427207.1 PREDICTED: serine/threonine-protein kinase dst1 i... 109 1e-24 XP_007153501.1 hypothetical protein PHAVU_003G041000g [Phaseolus... 109 1e-24 XP_006574952.1 PREDICTED: serine/threonine-protein kinase dst1-l... 109 1e-24 >KHN29973.1 Serine/threonine-protein kinase dst1 [Glycine soja] Length = 643 Score = 109 bits (272), Expect = 1e-24 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = -1 Query: 512 SIYQRLTSSSTLMNLAHALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL 345 SIYQRLTSSSTLMNLA ALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL Sbjct: 588 SIYQRLTSSSTLMNLAQALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL 643 >XP_003517847.1 PREDICTED: serine/threonine-protein kinase dst1-like isoform X2 [Glycine max] KRH75082.1 hypothetical protein GLYMA_01G061500 [Glycine max] Length = 795 Score = 109 bits (272), Expect = 1e-24 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = -1 Query: 512 SIYQRLTSSSTLMNLAHALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL 345 SIYQRLTSSSTLMNLA ALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL Sbjct: 740 SIYQRLTSSSTLMNLAQALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL 795 >XP_006573156.1 PREDICTED: serine/threonine-protein kinase dst1-like isoform X1 [Glycine max] Length = 796 Score = 109 bits (272), Expect = 1e-24 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = -1 Query: 512 SIYQRLTSSSTLMNLAHALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL 345 SIYQRLTSSSTLMNLA ALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL Sbjct: 741 SIYQRLTSSSTLMNLAQALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL 796 >KOM45858.1 hypothetical protein LR48_Vigan06g116400 [Vigna angularis] Length = 822 Score = 109 bits (272), Expect = 1e-24 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = -1 Query: 512 SIYQRLTSSSTLMNLAHALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL 345 SIYQRLTSSSTLMNLA ALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL Sbjct: 767 SIYQRLTSSSTLMNLAQALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL 822 >XP_016188519.1 PREDICTED: serine/threonine-protein kinase dst2 isoform X5 [Arachis ipaensis] Length = 825 Score = 109 bits (272), Expect = 1e-24 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = -1 Query: 512 SIYQRLTSSSTLMNLAHALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL 345 SIYQRLTSSSTLMNLA ALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL Sbjct: 770 SIYQRLTSSSTLMNLAQALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL 825 >XP_016188518.1 PREDICTED: serine/threonine-protein kinase dst2 isoform X4 [Arachis ipaensis] Length = 826 Score = 109 bits (272), Expect = 1e-24 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = -1 Query: 512 SIYQRLTSSSTLMNLAHALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL 345 SIYQRLTSSSTLMNLA ALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL Sbjct: 771 SIYQRLTSSSTLMNLAQALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL 826 >XP_016188517.1 PREDICTED: serine/threonine-protein kinase dst2 isoform X3 [Arachis ipaensis] Length = 826 Score = 109 bits (272), Expect = 1e-24 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = -1 Query: 512 SIYQRLTSSSTLMNLAHALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL 345 SIYQRLTSSSTLMNLA ALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL Sbjct: 771 SIYQRLTSSSTLMNLAQALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL 826 >XP_016188516.1 PREDICTED: serine/threonine-protein kinase dst2 isoform X2 [Arachis ipaensis] Length = 826 Score = 109 bits (272), Expect = 1e-24 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = -1 Query: 512 SIYQRLTSSSTLMNLAHALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL 345 SIYQRLTSSSTLMNLA ALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL Sbjct: 771 SIYQRLTSSSTLMNLAQALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL 826 >XP_016188514.1 PREDICTED: serine/threonine-protein kinase dst2 isoform X1 [Arachis ipaensis] XP_016188515.1 PREDICTED: serine/threonine-protein kinase dst2 isoform X1 [Arachis ipaensis] Length = 827 Score = 109 bits (272), Expect = 1e-24 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = -1 Query: 512 SIYQRLTSSSTLMNLAHALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL 345 SIYQRLTSSSTLMNLA ALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL Sbjct: 772 SIYQRLTSSSTLMNLAQALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL 827 >XP_015953628.1 PREDICTED: serine/threonine-protein kinase dst2 isoform X6 [Arachis duranensis] Length = 827 Score = 109 bits (272), Expect = 1e-24 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = -1 Query: 512 SIYQRLTSSSTLMNLAHALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL 345 SIYQRLTSSSTLMNLA ALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL Sbjct: 772 SIYQRLTSSSTLMNLAQALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL 827 >XP_015953627.1 PREDICTED: serine/threonine-protein kinase dst2 isoform X5 [Arachis duranensis] Length = 827 Score = 109 bits (272), Expect = 1e-24 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = -1 Query: 512 SIYQRLTSSSTLMNLAHALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL 345 SIYQRLTSSSTLMNLA ALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL Sbjct: 772 SIYQRLTSSSTLMNLAQALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL 827 >XP_015953626.1 PREDICTED: serine/threonine-protein kinase dst2 isoform X4 [Arachis duranensis] Length = 828 Score = 109 bits (272), Expect = 1e-24 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = -1 Query: 512 SIYQRLTSSSTLMNLAHALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL 345 SIYQRLTSSSTLMNLA ALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL Sbjct: 773 SIYQRLTSSSTLMNLAQALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL 828 >XP_015953625.1 PREDICTED: serine/threonine-protein kinase dst2 isoform X3 [Arachis duranensis] Length = 828 Score = 109 bits (272), Expect = 1e-24 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = -1 Query: 512 SIYQRLTSSSTLMNLAHALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL 345 SIYQRLTSSSTLMNLA ALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL Sbjct: 773 SIYQRLTSSSTLMNLAQALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL 828 >XP_015953624.1 PREDICTED: serine/threonine-protein kinase dst2 isoform X2 [Arachis duranensis] Length = 828 Score = 109 bits (272), Expect = 1e-24 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = -1 Query: 512 SIYQRLTSSSTLMNLAHALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL 345 SIYQRLTSSSTLMNLA ALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL Sbjct: 773 SIYQRLTSSSTLMNLAQALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL 828 >KYP65718.1 Serine/threonine-protein kinase dst1, partial [Cajanus cajan] Length = 829 Score = 109 bits (272), Expect = 1e-24 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = -1 Query: 512 SIYQRLTSSSTLMNLAHALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL 345 SIYQRLTSSSTLMNLA ALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL Sbjct: 774 SIYQRLTSSSTLMNLAQALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL 829 >XP_015953622.1 PREDICTED: serine/threonine-protein kinase dst2 isoform X1 [Arachis duranensis] XP_015953623.1 PREDICTED: serine/threonine-protein kinase dst2 isoform X1 [Arachis duranensis] Length = 829 Score = 109 bits (272), Expect = 1e-24 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = -1 Query: 512 SIYQRLTSSSTLMNLAHALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL 345 SIYQRLTSSSTLMNLA ALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL Sbjct: 774 SIYQRLTSSSTLMNLAQALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL 829 >XP_007153500.1 hypothetical protein PHAVU_003G041000g [Phaseolus vulgaris] ESW25494.1 hypothetical protein PHAVU_003G041000g [Phaseolus vulgaris] Length = 833 Score = 109 bits (272), Expect = 1e-24 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = -1 Query: 512 SIYQRLTSSSTLMNLAHALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL 345 SIYQRLTSSSTLMNLA ALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL Sbjct: 778 SIYQRLTSSSTLMNLAQALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL 833 >XP_017427207.1 PREDICTED: serine/threonine-protein kinase dst1 isoform X3 [Vigna angularis] Length = 834 Score = 109 bits (272), Expect = 1e-24 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = -1 Query: 512 SIYQRLTSSSTLMNLAHALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL 345 SIYQRLTSSSTLMNLA ALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL Sbjct: 779 SIYQRLTSSSTLMNLAQALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL 834 >XP_007153501.1 hypothetical protein PHAVU_003G041000g [Phaseolus vulgaris] ESW25495.1 hypothetical protein PHAVU_003G041000g [Phaseolus vulgaris] Length = 834 Score = 109 bits (272), Expect = 1e-24 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = -1 Query: 512 SIYQRLTSSSTLMNLAHALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL 345 SIYQRLTSSSTLMNLA ALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL Sbjct: 779 SIYQRLTSSSTLMNLAQALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL 834 >XP_006574952.1 PREDICTED: serine/threonine-protein kinase dst1-like isoform X2 [Glycine max] XP_006574953.1 PREDICTED: serine/threonine-protein kinase dst1-like isoform X2 [Glycine max] KRH70943.1 hypothetical protein GLYMA_02G119700 [Glycine max] Length = 835 Score = 109 bits (272), Expect = 1e-24 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = -1 Query: 512 SIYQRLTSSSTLMNLAHALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL 345 SIYQRLTSSSTLMNLA ALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL Sbjct: 780 SIYQRLTSSSTLMNLAQALAYHKMCYEDMPLQELQATQEQRTIQNLSDTLRTILRL 835