BLASTX nr result
ID: Glycyrrhiza28_contig00028822
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00028822 (601 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013465972.1 phytosulfokine precursor protein [Medicago trunca... 94 8e-22 XP_004498978.1 PREDICTED: phytosulfokines-like [Cicer arietinum] 93 1e-21 KHN45129.1 Phytosulfokines 3 [Glycine soja] KRH52128.1 hypotheti... 84 6e-18 AIS76460.1 phytosulfokine-alpha precursor 3 [Lotus japonicus] 84 8e-18 NP_001240852.1 phytosulfokines 3-like precursor [Glycine max] DA... 80 1e-16 XP_013465970.1 phytosulfokine precursor protein [Medicago trunca... 78 1e-15 KYP46217.1 Phytosulfokines 3 [Cajanus cajan] 77 3e-15 KRH05552.1 hypothetical protein GLYMA_17G233400 [Glycine max] 75 2e-14 DAA00282.1 TPA_exp: putative phytosulfokine peptide precursor [G... 75 2e-14 XP_018808728.1 PREDICTED: phytosulfokines-like [Juglans regia] 74 6e-14 KHN36980.1 Phytosulfokines 3 [Glycine soja] 73 1e-13 KRH05553.1 hypothetical protein GLYMA_17G233500 [Glycine max] 72 2e-13 XP_016163889.1 PREDICTED: phytosulfokines 3-like [Arachis ipaensis] 72 4e-13 XP_015935108.1 PREDICTED: phytosulfokines 3-like [Arachis durane... 71 9e-13 XP_008237502.1 PREDICTED: phytosulfokines 3-like [Prunus mume] 69 2e-12 XP_012451457.1 PREDICTED: phytosulfokines-like [Gossypium raimon... 67 2e-11 XP_016717720.1 PREDICTED: phytosulfokines-like [Gossypium hirsut... 67 2e-11 XP_004498977.1 PREDICTED: phytosulfokines-like [Cicer arietinum] 67 2e-11 XP_012570790.1 PREDICTED: phytosulfokines-like [Cicer arietinum] 67 3e-11 KYP39477.1 Phytosulfokines 3 [Cajanus cajan] 66 4e-11 >XP_013465972.1 phytosulfokine precursor protein [Medicago truncatula] KEH40008.1 phytosulfokine precursor protein [Medicago truncatula] Length = 83 Score = 94.0 bits (232), Expect = 8e-22 Identities = 45/64 (70%), Positives = 55/64 (85%), Gaps = 1/64 (1%) Frame = -2 Query: 408 ASRPSLGFKGISSLHEDVEANKLSELD-DDESCEGAEGVEECLTRRTLAAHVDYIYTQKH 232 ASRP+ FKG+SSLHED+ ++K S +D +DE+CEG EG +ECLTRRTLAAH+DYIYTQ H Sbjct: 21 ASRPNFVFKGVSSLHEDIVSSKASSVDLEDENCEGVEGEQECLTRRTLAAHLDYIYTQ-H 79 Query: 231 KPKN 220 KPKN Sbjct: 80 KPKN 83 >XP_004498978.1 PREDICTED: phytosulfokines-like [Cicer arietinum] Length = 80 Score = 93.2 bits (230), Expect = 1e-21 Identities = 50/65 (76%), Positives = 55/65 (84%), Gaps = 1/65 (1%) Frame = -2 Query: 411 YASRPSLGFKGISSLHEDVEANK-LSELDDDESCEGAEGVEECLTRRTLAAHVDYIYTQK 235 +ASRP+LGFKG+SSLHEDV NK LSE DDESCEG E ECLTRRTLAAH+DYIYTQ Sbjct: 20 FASRPNLGFKGVSSLHEDVVVNKALSEELDDESCEGEE---ECLTRRTLAAHIDYIYTQ- 75 Query: 234 HKPKN 220 +KPKN Sbjct: 76 NKPKN 80 >KHN45129.1 Phytosulfokines 3 [Glycine soja] KRH52128.1 hypothetical protein GLYMA_06G048200 [Glycine max] Length = 80 Score = 84.0 bits (206), Expect = 6e-18 Identities = 42/63 (66%), Positives = 47/63 (74%), Gaps = 1/63 (1%) Frame = -2 Query: 411 YASRPSLGFKGISSLHEDVEANKLS-ELDDDESCEGAEGVEECLTRRTLAAHVDYIYTQK 235 YASRP++ F I S H DV A K + + DDESCEG +G EECL RRTL AHVDYIYTQK Sbjct: 18 YASRPNVEFDAIISPHRDVSAYKTALAVLDDESCEGIDGSEECLMRRTLVAHVDYIYTQK 77 Query: 234 HKP 226 HKP Sbjct: 78 HKP 80 >AIS76460.1 phytosulfokine-alpha precursor 3 [Lotus japonicus] Length = 77 Score = 83.6 bits (205), Expect = 8e-18 Identities = 41/60 (68%), Positives = 44/60 (73%) Frame = -2 Query: 399 PSLGFKGISSLHEDVEANKLSELDDDESCEGAEGVEECLTRRTLAAHVDYIYTQKHKPKN 220 P L FKG SSL+ED ANK E CEG EG EECL RRTLAAH+DYIYTQKHKP+N Sbjct: 25 PDLEFKGASSLYEDFAANK-------EDCEGVEGTEECLQRRTLAAHLDYIYTQKHKPQN 77 >NP_001240852.1 phytosulfokines 3-like precursor [Glycine max] DAA00283.1 TPA_exp: putative phytosulfokine peptide precursor [Glycine max] KHN17171.1 Phytosulfokines 3 [Glycine soja] KRG88754.1 hypothetical protein GLYMA_U029600 [Glycine max] Length = 79 Score = 80.5 bits (197), Expect = 1e-16 Identities = 43/63 (68%), Positives = 47/63 (74%) Frame = -2 Query: 411 YASRPSLGFKGISSLHEDVEANKLSELDDDESCEGAEGVEECLTRRTLAAHVDYIYTQKH 232 +ASRP+ +SS HEDV A K E D+ESCE EG EECL RRTLAAHVDYIYTQKH Sbjct: 20 HASRPNPSLNVVSSSHEDVAATK--EEIDEESCE--EGTEECLIRRTLAAHVDYIYTQKH 75 Query: 231 KPK 223 KPK Sbjct: 76 KPK 78 >XP_013465970.1 phytosulfokine precursor protein [Medicago truncatula] KEH40006.1 phytosulfokine precursor protein [Medicago truncatula] Length = 81 Score = 78.2 bits (191), Expect = 1e-15 Identities = 37/57 (64%), Positives = 45/57 (78%) Frame = -2 Query: 411 YASRPSLGFKGISSLHEDVEANKLSELDDDESCEGAEGVEECLTRRTLAAHVDYIYT 241 YASRP++G +SSL++DV A S +DESCEG EG +ECLTRRTLAAH+DYIYT Sbjct: 20 YASRPNVGLNSVSSLNKDVSATNASS--EDESCEGLEGEQECLTRRTLAAHLDYIYT 74 >KYP46217.1 Phytosulfokines 3 [Cajanus cajan] Length = 78 Score = 77.0 bits (188), Expect = 3e-15 Identities = 42/63 (66%), Positives = 44/63 (69%) Frame = -2 Query: 411 YASRPSLGFKGISSLHEDVEANKLSELDDDESCEGAEGVEECLTRRTLAAHVDYIYTQKH 232 YASRP+ +SSLH DVE L DDESCE E EECL RRTLAAH DYIYTQKH Sbjct: 20 YASRPNPSHNTVSSLHVDVE---LKAEIDDESCE--EDTEECLMRRTLAAHTDYIYTQKH 74 Query: 231 KPK 223 KPK Sbjct: 75 KPK 77 >KRH05552.1 hypothetical protein GLYMA_17G233400 [Glycine max] Length = 82 Score = 75.1 bits (183), Expect = 2e-14 Identities = 40/61 (65%), Positives = 44/61 (72%) Frame = -2 Query: 411 YASRPSLGFKGISSLHEDVEANKLSELDDDESCEGAEGVEECLTRRTLAAHVDYIYTQKH 232 YASRP+ +SSLH DV A K E+D ESCE EG EECL RRTLAAH+DYIYTQK Sbjct: 20 YASRPNPSLISVSSLHGDVAATKAEEIDG-ESCE--EGTEECLARRTLAAHLDYIYTQKD 76 Query: 231 K 229 K Sbjct: 77 K 77 >DAA00282.1 TPA_exp: putative phytosulfokine peptide precursor [Glycine max] Length = 79 Score = 74.7 bits (182), Expect = 2e-14 Identities = 42/63 (66%), Positives = 46/63 (73%) Frame = -2 Query: 411 YASRPSLGFKGISSLHEDVEANKLSELDDDESCEGAEGVEECLTRRTLAAHVDYIYTQKH 232 +ASR + K SSL EDV A K E ++ESCE EG EECL RRTLAAHVDYIYTQKH Sbjct: 20 HASRLNPSLKVFSSLREDVAATK--EEINEESCE--EGTEECLIRRTLAAHVDYIYTQKH 75 Query: 231 KPK 223 KPK Sbjct: 76 KPK 78 >XP_018808728.1 PREDICTED: phytosulfokines-like [Juglans regia] Length = 80 Score = 73.6 bits (179), Expect = 6e-14 Identities = 36/62 (58%), Positives = 43/62 (69%) Frame = -2 Query: 411 YASRPSLGFKGISSLHEDVEANKLSELDDDESCEGAEGVEECLTRRTLAAHVDYIYTQKH 232 YA+RP F G + + K +++ DESCEG EG EECL RRTLAAH+DYIYTQKH Sbjct: 24 YAARPEPAFPG-----DSLAGVKPEKVEVDESCEGVEGKEECLMRRTLAAHLDYIYTQKH 78 Query: 231 KP 226 KP Sbjct: 79 KP 80 >KHN36980.1 Phytosulfokines 3 [Glycine soja] Length = 80 Score = 72.8 bits (177), Expect = 1e-13 Identities = 40/63 (63%), Positives = 46/63 (73%) Frame = -2 Query: 411 YASRPSLGFKGISSLHEDVEANKLSELDDDESCEGAEGVEECLTRRTLAAHVDYIYTQKH 232 +AS P+ +SSL+ DV A K E ++ESCE EG EECL RRTLAAHVDYIYTQKH Sbjct: 21 HASHPNPSLDIVSSLNGDVAATK--EEINEESCE--EGTEECLIRRTLAAHVDYIYTQKH 76 Query: 231 KPK 223 KPK Sbjct: 77 KPK 79 >KRH05553.1 hypothetical protein GLYMA_17G233500 [Glycine max] Length = 60 Score = 71.6 bits (174), Expect = 2e-13 Identities = 42/59 (71%), Positives = 44/59 (74%) Frame = -2 Query: 399 PSLGFKGISSLHEDVEANKLSELDDDESCEGAEGVEECLTRRTLAAHVDYIYTQKHKPK 223 PSL K SSL EDV A K E ++ESCE EG EECL RRTLAAHVDYIYTQKHKPK Sbjct: 7 PSL--KVFSSLREDVAATK--EEINEESCE--EGTEECLIRRTLAAHVDYIYTQKHKPK 59 >XP_016163889.1 PREDICTED: phytosulfokines 3-like [Arachis ipaensis] Length = 91 Score = 71.6 bits (174), Expect = 4e-13 Identities = 40/69 (57%), Positives = 48/69 (69%), Gaps = 5/69 (7%) Frame = -2 Query: 411 YASRPSLGFKGI-----SSLHEDVEANKLSELDDDESCEGAEGVEECLTRRTLAAHVDYI 247 YASRP + F + SSLHEDV+ K + DDE+CEG +ECL RRTLAAH+DYI Sbjct: 28 YASRPHIEFDAVTMVSSSSLHEDVKTYKEGDQLDDENCEG----DECLMRRTLAAHLDYI 83 Query: 246 YTQKHKPKN 220 YTQ +KPKN Sbjct: 84 YTQ-NKPKN 91 >XP_015935108.1 PREDICTED: phytosulfokines 3-like [Arachis duranensis] Length = 91 Score = 70.9 bits (172), Expect = 9e-13 Identities = 40/69 (57%), Positives = 48/69 (69%), Gaps = 5/69 (7%) Frame = -2 Query: 411 YASRPSLGFKGI-----SSLHEDVEANKLSELDDDESCEGAEGVEECLTRRTLAAHVDYI 247 YASRP + F + SS+HEDV+ K + DDE+CEG EECL RRTLAAH+DYI Sbjct: 28 YASRPHVEFDAMTMISSSSMHEDVKTYKEGDQLDDENCEG----EECLMRRTLAAHLDYI 83 Query: 246 YTQKHKPKN 220 YTQ +KPKN Sbjct: 84 YTQ-NKPKN 91 >XP_008237502.1 PREDICTED: phytosulfokines 3-like [Prunus mume] Length = 77 Score = 69.3 bits (168), Expect = 2e-12 Identities = 37/62 (59%), Positives = 41/62 (66%) Frame = -2 Query: 411 YASRPSLGFKGISSLHEDVEANKLSELDDDESCEGAEGVEECLTRRTLAAHVDYIYTQKH 232 YA+RP F +S +E E + DESCEGA G EECL RRTLAAHVDYIYTQKH Sbjct: 20 YAARPEPDFSAATSAKTQIEG---VETEVDESCEGA-GEEECLMRRTLAAHVDYIYTQKH 75 Query: 231 KP 226 P Sbjct: 76 NP 77 >XP_012451457.1 PREDICTED: phytosulfokines-like [Gossypium raimondii] XP_016726931.1 PREDICTED: phytosulfokines-like [Gossypium hirsutum] KJB63953.1 hypothetical protein B456_010G026700 [Gossypium raimondii] Length = 75 Score = 67.0 bits (162), Expect = 2e-11 Identities = 38/62 (61%), Positives = 42/62 (67%) Frame = -2 Query: 411 YASRPSLGFKGISSLHEDVEANKLSELDDDESCEGAEGVEECLTRRTLAAHVDYIYTQKH 232 YA+RP + HE VEA K+ D DE+CEG G EECL RRTLAAHVDYIYTQ H Sbjct: 20 YAARPEPTLS--LTQHEGVEAEKV---DADENCEGI-GKEECLMRRTLAAHVDYIYTQNH 73 Query: 231 KP 226 KP Sbjct: 74 KP 75 >XP_016717720.1 PREDICTED: phytosulfokines-like [Gossypium hirsutum] XP_017645130.1 PREDICTED: phytosulfokines-like [Gossypium arboreum] KHG26689.1 Phytosulfokines 3 -like protein [Gossypium arboreum] Length = 75 Score = 67.0 bits (162), Expect = 2e-11 Identities = 38/62 (61%), Positives = 42/62 (67%) Frame = -2 Query: 411 YASRPSLGFKGISSLHEDVEANKLSELDDDESCEGAEGVEECLTRRTLAAHVDYIYTQKH 232 YA+RP + HE VEA K+ D DE+CEG G EECL RRTLAAHVDYIYTQ H Sbjct: 20 YAARPEPTLS--LTQHEGVEAEKV---DADENCEGI-GKEECLMRRTLAAHVDYIYTQNH 73 Query: 231 KP 226 KP Sbjct: 74 KP 75 >XP_004498977.1 PREDICTED: phytosulfokines-like [Cicer arietinum] Length = 86 Score = 67.0 bits (162), Expect = 2e-11 Identities = 35/64 (54%), Positives = 45/64 (70%), Gaps = 2/64 (3%) Frame = -2 Query: 411 YASRPSLGFKGISSLHEDVEANKLSELDD--DESCEGAEGVEECLTRRTLAAHVDYIYTQ 238 YASRP++G ++ +H+DV A+K S D +ESCEG +G EECL RRTL AH+DYIYT Sbjct: 20 YASRPNIG---LNDVHKDVVASKASSNVDLGEESCEGGKGEEECLARRTLDAHLDYIYTN 76 Query: 237 KHKP 226 P Sbjct: 77 LSIP 80 >XP_012570790.1 PREDICTED: phytosulfokines-like [Cicer arietinum] Length = 86 Score = 66.6 bits (161), Expect = 3e-11 Identities = 35/59 (59%), Positives = 42/59 (71%), Gaps = 2/59 (3%) Frame = -2 Query: 411 YASRPSLGFKGISSLHEDVEANKLSELDD--DESCEGAEGVEECLTRRTLAAHVDYIYT 241 YASRP++GF + EDV A+K S D +ESCEG +G EECL RRTL AH+DYIYT Sbjct: 20 YASRPNIGFNDV---REDVVASKASSNVDLGEESCEGGKGEEECLARRTLDAHLDYIYT 75 >KYP39477.1 Phytosulfokines 3 [Cajanus cajan] Length = 77 Score = 66.2 bits (160), Expect = 4e-11 Identities = 39/63 (61%), Positives = 44/63 (69%), Gaps = 1/63 (1%) Frame = -2 Query: 411 YASRPSLGFK-GISSLHEDVEANKLSELDDDESCEGAEGVEECLTRRTLAAHVDYIYTQK 235 YAS P++ F I S H DV A L DDESCEG ++ECL RRTLAAHVDYIYTQK Sbjct: 22 YASPPNVQFDDAIFSPHGDVAAYVL----DDESCEG---IDECLMRRTLAAHVDYIYTQK 74 Query: 234 HKP 226 +KP Sbjct: 75 NKP 77