BLASTX nr result
ID: Glycyrrhiza28_contig00028701
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00028701 (277 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU18772.1 hypothetical protein TSUD_80610 [Trifolium subterraneum] 53 1e-11 >GAU18772.1 hypothetical protein TSUD_80610 [Trifolium subterraneum] Length = 482 Score = 52.8 bits (125), Expect(2) = 1e-11 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = +3 Query: 78 LCPRCQDVNESIMHSLRDCEQVKEFWERVV 167 LCPRCQD ESIMH LRDCE +EFW ++ Sbjct: 218 LCPRCQDYPESIMHCLRDCEDAREFWTNII 247 Score = 43.9 bits (102), Expect(2) = 1e-11 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +2 Query: 8 WQWKGPNRYKSFLWKLAHGRL 70 W WKGPNR K+FLWKL+ GRL Sbjct: 182 WHWKGPNRIKAFLWKLSQGRL 202