BLASTX nr result
ID: Glycyrrhiza28_contig00028680
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00028680 (602 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AAZ32886.1 putative origin recognition complex subunit 6-contain... 58 1e-07 XP_013448285.1 origin recognition complex subunit 6 [Medicago tr... 58 1e-06 GAU42567.1 hypothetical protein TSUD_240430 [Trifolium subterran... 58 1e-06 XP_003613742.1 origin recognition complex subunit 6 [Medicago tr... 57 3e-06 XP_004490041.1 PREDICTED: origin of replication complex subunit ... 56 5e-06 >AAZ32886.1 putative origin recognition complex subunit 6-containing protein [Medicago sativa] Length = 107 Score = 57.8 bits (138), Expect = 1e-07 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = +3 Query: 201 FGAAKERKNPMEVKISRNMLHVLPNKKTLEDGGYLSDDELE 323 FG AKE+K+P EVK +R++L VLP+K+ EDGGYLSDD E Sbjct: 9 FGVAKEKKDPKEVKTNRDLLDVLPSKRKAEDGGYLSDDGAE 49 >XP_013448285.1 origin recognition complex subunit 6 [Medicago truncatula] KEH22312.1 origin recognition complex subunit 6 [Medicago truncatula] Length = 287 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = +3 Query: 201 FGAAKERKNPMEVKISRNMLHVLPNKKTLEDGGYLSDDELE 323 FG AKE+K+P EVK +R++L VLP+K+ EDGGYLSDD E Sbjct: 189 FGVAKEKKDPKEVKTNRDLLDVLPSKRKAEDGGYLSDDGAE 229 >GAU42567.1 hypothetical protein TSUD_240430 [Trifolium subterraneum] Length = 301 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = +3 Query: 201 FGAAKERKNPMEVKISRNMLHVLPNKKTLEDGGYLSDDELE 323 FG AKE+K+P EVK +R++L VLP+K+ EDGGYLSDD E Sbjct: 189 FGVAKEKKDPKEVKTNRDLLDVLPSKRKAEDGGYLSDDGAE 229 >XP_003613742.1 origin recognition complex subunit 6 [Medicago truncatula] AES96700.1 origin recognition complex subunit 6 [Medicago truncatula] Length = 287 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = +3 Query: 201 FGAAKERKNPMEVKISRNMLHVLPNKKTLEDGGYLSDD 314 FG AKE+K+P EVK +R++L VLP+K+ EDGGYLSDD Sbjct: 189 FGVAKEKKDPKEVKTNRDLLDVLPSKRKAEDGGYLSDD 226 >XP_004490041.1 PREDICTED: origin of replication complex subunit 6 [Cicer arietinum] Length = 287 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = +3 Query: 201 FGAAKERKNPMEVKISRNMLHVLPNKKTLEDGGYLSDDELE 323 FG AKE+K+P EVK +R++L LP+K+ EDGGYLSDD E Sbjct: 189 FGVAKEKKDPKEVKTNRDLLDALPSKRKAEDGGYLSDDGAE 229