BLASTX nr result
ID: Glycyrrhiza28_contig00028620
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00028620 (511 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_002306594.1 hypothetical protein POPTR_0005s16475g [Populus t... 74 3e-14 ONK69943.1 uncharacterized protein A4U43_C05F28580, partial [Asp... 78 5e-14 KNA17107.1 hypothetical protein SOVF_083190 [Spinacia oleracea] 76 2e-13 XP_010686393.1 PREDICTED: guanylate-binding protein 3 [Beta vulg... 76 2e-13 ONK66397.1 uncharacterized protein A4U43_C06F7420 [Asparagus off... 76 2e-13 XP_009389410.1 PREDICTED: guanylate-binding protein 3 [Musa acum... 75 3e-13 XP_008789979.1 PREDICTED: guanylate-binding protein 4-like [Phoe... 75 3e-13 OMO76327.1 hypothetical protein CCACVL1_15735 [Corchorus capsula... 75 3e-13 KDO77712.1 hypothetical protein CISIN_1g001482mg [Citrus sinensis] 75 3e-13 XP_006467722.1 PREDICTED: guanylate-binding protein 1 [Citrus si... 75 3e-13 XP_006852574.1 PREDICTED: guanylate-binding protein 5 [Amborella... 75 3e-13 OMO65258.1 hypothetical protein COLO4_31408 [Corchorus olitorius] 75 3e-13 XP_016711217.1 PREDICTED: guanylate-binding protein 3-like [Goss... 75 3e-13 AQK69340.1 Guanylate-binding family protein [Zea mays] 75 3e-13 XP_010111168.1 Interferon-induced guanylate-binding protein 2 [M... 75 3e-13 XP_012454136.1 PREDICTED: guanylate-binding protein 3-like [Goss... 75 3e-13 GAV87507.1 GBP domain-containing protein/GBP_C domain-containing... 75 3e-13 XP_010518777.1 PREDICTED: guanylate-binding protein 1 isoform X1... 75 3e-13 XP_015875127.1 PREDICTED: guanylate-binding protein 3 isoform X1... 75 3e-13 XP_008439803.1 PREDICTED: guanylate-binding protein 2 [Cucumis m... 75 3e-13 >XP_002306594.1 hypothetical protein POPTR_0005s16475g [Populus trichocarpa] EEE93590.1 hypothetical protein POPTR_0005s16475g [Populus trichocarpa] Length = 112 Score = 74.3 bits (181), Expect = 3e-14 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = -3 Query: 419 LLGRSSGFQVSSTH*PCTKGLWYWSVSLKRTTFDGTEYNLL 297 LLGRSSGFQV+STH PCTKGLW WS LKRT DGT+YNLL Sbjct: 11 LLGRSSGFQVASTHRPCTKGLWLWSAPLKRTALDGTQYNLL 51 >ONK69943.1 uncharacterized protein A4U43_C05F28580, partial [Asparagus officinalis] Length = 337 Score = 78.2 bits (191), Expect(2) = 5e-14 Identities = 37/53 (69%), Positives = 42/53 (79%) Frame = -3 Query: 455 LRMLESSEAIG*LLGRSSGFQVSSTH*PCTKGLWYWSVSLKRTTFDGTEYNLL 297 LRML+S LLGRSSGFQV+STH PCTKGLW WS +KRT+ DGTEYNL+ Sbjct: 62 LRMLKSICGFWQLLGRSSGFQVASTHRPCTKGLWMWSAPIKRTSLDGTEYNLV 114 Score = 26.6 bits (57), Expect(2) = 5e-14 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -1 Query: 295 LLESEGINAYDQT 257 LL+SEGI+AYDQT Sbjct: 115 LLDSEGIDAYDQT 127 >KNA17107.1 hypothetical protein SOVF_083190 [Spinacia oleracea] Length = 1080 Score = 76.3 bits (186), Expect(2) = 2e-13 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -3 Query: 419 LLGRSSGFQVSSTH*PCTKGLWYWSVSLKRTTFDGTEYNLL 297 LLGRSSGFQV+STH PCTKGLW WSV LKRT DGTEYNL+ Sbjct: 103 LLGRSSGFQVASTHKPCTKGLWLWSVPLKRTALDGTEYNLI 143 Score = 26.6 bits (57), Expect(2) = 2e-13 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -1 Query: 295 LLESEGINAYDQT 257 LL+SEGI+AYDQT Sbjct: 144 LLDSEGIDAYDQT 156 >XP_010686393.1 PREDICTED: guanylate-binding protein 3 [Beta vulgaris subsp. vulgaris] KMT04588.1 hypothetical protein BVRB_8g182440 [Beta vulgaris subsp. vulgaris] Length = 1078 Score = 76.3 bits (186), Expect(2) = 2e-13 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -3 Query: 419 LLGRSSGFQVSSTH*PCTKGLWYWSVSLKRTTFDGTEYNLL 297 LLGRSSGFQV+STH PCTKGLW WSV LKRT DGTEYNL+ Sbjct: 99 LLGRSSGFQVASTHKPCTKGLWLWSVPLKRTALDGTEYNLI 139 Score = 26.6 bits (57), Expect(2) = 2e-13 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -1 Query: 295 LLESEGINAYDQT 257 LL+SEGI+AYDQT Sbjct: 140 LLDSEGIDAYDQT 152 >ONK66397.1 uncharacterized protein A4U43_C06F7420 [Asparagus officinalis] Length = 1029 Score = 76.3 bits (186), Expect(2) = 2e-13 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -3 Query: 419 LLGRSSGFQVSSTH*PCTKGLWYWSVSLKRTTFDGTEYNLL 297 LLGRSSGFQV+STH PCTKGLW WSV +KRT DGTEYNLL Sbjct: 54 LLGRSSGFQVASTHRPCTKGLWMWSVPIKRTALDGTEYNLL 94 Score = 26.6 bits (57), Expect(2) = 2e-13 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -1 Query: 295 LLESEGINAYDQT 257 LL+SEGI+AYDQT Sbjct: 95 LLDSEGIDAYDQT 107 >XP_009389410.1 PREDICTED: guanylate-binding protein 3 [Musa acuminata subsp. malaccensis] Length = 1078 Score = 75.5 bits (184), Expect(2) = 3e-13 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = -3 Query: 419 LLGRSSGFQVSSTH*PCTKGLWYWSVSLKRTTFDGTEYNLL 297 LLGRSSGFQV+STH PCTKGLW WS LKRT DGTEYNLL Sbjct: 98 LLGRSSGFQVASTHRPCTKGLWMWSTPLKRTALDGTEYNLL 138 Score = 26.6 bits (57), Expect(2) = 3e-13 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -1 Query: 295 LLESEGINAYDQT 257 LL+SEGI+AYDQT Sbjct: 139 LLDSEGIDAYDQT 151 >XP_008789979.1 PREDICTED: guanylate-binding protein 4-like [Phoenix dactylifera] Length = 1078 Score = 75.5 bits (184), Expect(2) = 3e-13 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = -3 Query: 419 LLGRSSGFQVSSTH*PCTKGLWYWSVSLKRTTFDGTEYNLL 297 LLGRSSGFQV+STH PCTKGLW WS LKRT DGTEYNLL Sbjct: 98 LLGRSSGFQVASTHRPCTKGLWLWSAPLKRTALDGTEYNLL 138 Score = 26.6 bits (57), Expect(2) = 3e-13 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -1 Query: 295 LLESEGINAYDQT 257 LL+SEGI+AYDQT Sbjct: 139 LLDSEGIDAYDQT 151 >OMO76327.1 hypothetical protein CCACVL1_15735 [Corchorus capsularis] Length = 1073 Score = 75.5 bits (184), Expect(2) = 3e-13 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = -3 Query: 419 LLGRSSGFQVSSTH*PCTKGLWYWSVSLKRTTFDGTEYNLL 297 LLGRSSGFQV+STH PCTKGLW WS LKRT DGTEYNLL Sbjct: 94 LLGRSSGFQVASTHRPCTKGLWLWSAPLKRTALDGTEYNLL 134 Score = 26.6 bits (57), Expect(2) = 3e-13 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -1 Query: 295 LLESEGINAYDQT 257 LL+SEGI+AYDQT Sbjct: 135 LLDSEGIDAYDQT 147 >KDO77712.1 hypothetical protein CISIN_1g001482mg [Citrus sinensis] Length = 1070 Score = 75.5 bits (184), Expect(2) = 3e-13 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = -3 Query: 419 LLGRSSGFQVSSTH*PCTKGLWYWSVSLKRTTFDGTEYNLL 297 LLGRSSGFQV+STH PCTKGLW WS LKRT DGTEYNLL Sbjct: 91 LLGRSSGFQVASTHRPCTKGLWLWSAPLKRTALDGTEYNLL 131 Score = 26.6 bits (57), Expect(2) = 3e-13 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -1 Query: 295 LLESEGINAYDQT 257 LL+SEGI+AYDQT Sbjct: 132 LLDSEGIDAYDQT 144 >XP_006467722.1 PREDICTED: guanylate-binding protein 1 [Citrus sinensis] Length = 1070 Score = 75.5 bits (184), Expect(2) = 3e-13 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = -3 Query: 419 LLGRSSGFQVSSTH*PCTKGLWYWSVSLKRTTFDGTEYNLL 297 LLGRSSGFQV+STH PCTKGLW WS LKRT DGTEYNLL Sbjct: 91 LLGRSSGFQVASTHRPCTKGLWLWSAPLKRTALDGTEYNLL 131 Score = 26.6 bits (57), Expect(2) = 3e-13 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -1 Query: 295 LLESEGINAYDQT 257 LL+SEGI+AYDQT Sbjct: 132 LLDSEGIDAYDQT 144 >XP_006852574.1 PREDICTED: guanylate-binding protein 5 [Amborella trichopoda] ERN14041.1 hypothetical protein AMTR_s00021p00207790 [Amborella trichopoda] Length = 1070 Score = 75.5 bits (184), Expect(2) = 3e-13 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = -3 Query: 419 LLGRSSGFQVSSTH*PCTKGLWYWSVSLKRTTFDGTEYNLL 297 LLGRSSGFQV+STH PCTKGLW WS LKRT DGTEYNLL Sbjct: 88 LLGRSSGFQVASTHRPCTKGLWMWSAPLKRTALDGTEYNLL 128 Score = 26.6 bits (57), Expect(2) = 3e-13 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -1 Query: 295 LLESEGINAYDQT 257 LL+SEGI+AYDQT Sbjct: 129 LLDSEGIDAYDQT 141 >OMO65258.1 hypothetical protein COLO4_31408 [Corchorus olitorius] Length = 1069 Score = 75.5 bits (184), Expect(2) = 3e-13 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = -3 Query: 419 LLGRSSGFQVSSTH*PCTKGLWYWSVSLKRTTFDGTEYNLL 297 LLGRSSGFQV+STH PCTKGLW WS LKRT DGTEYNLL Sbjct: 90 LLGRSSGFQVASTHRPCTKGLWLWSAPLKRTALDGTEYNLL 130 Score = 26.6 bits (57), Expect(2) = 3e-13 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -1 Query: 295 LLESEGINAYDQT 257 LL+SEGI+AYDQT Sbjct: 131 LLDSEGIDAYDQT 143 >XP_016711217.1 PREDICTED: guanylate-binding protein 3-like [Gossypium hirsutum] Length = 1069 Score = 75.5 bits (184), Expect(2) = 3e-13 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = -3 Query: 419 LLGRSSGFQVSSTH*PCTKGLWYWSVSLKRTTFDGTEYNLL 297 LLGRSSGFQV+STH PCTKGLW WS LKRT DGTEYNLL Sbjct: 91 LLGRSSGFQVASTHRPCTKGLWLWSAPLKRTALDGTEYNLL 131 Score = 26.6 bits (57), Expect(2) = 3e-13 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -1 Query: 295 LLESEGINAYDQT 257 LL+SEGI+AYDQT Sbjct: 132 LLDSEGIDAYDQT 144 >AQK69340.1 Guanylate-binding family protein [Zea mays] Length = 1069 Score = 75.1 bits (183), Expect(2) = 3e-13 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -3 Query: 419 LLGRSSGFQVSSTH*PCTKGLWYWSVSLKRTTFDGTEYNLL 297 LLGRSSGFQV+STH PCTKGLW WS +KRT FDGTEY+LL Sbjct: 112 LLGRSSGFQVASTHRPCTKGLWMWSAPIKRTAFDGTEYSLL 152 Score = 26.9 bits (58), Expect(2) = 3e-13 Identities = 11/14 (78%), Positives = 14/14 (100%) Frame = -1 Query: 295 LLESEGINAYDQTV 254 LL+SEGI+AYDQT+ Sbjct: 153 LLDSEGIDAYDQTM 166 >XP_010111168.1 Interferon-induced guanylate-binding protein 2 [Morus notabilis] EXC30559.1 Interferon-induced guanylate-binding protein 2 [Morus notabilis] Length = 1067 Score = 75.5 bits (184), Expect(2) = 3e-13 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = -3 Query: 419 LLGRSSGFQVSSTH*PCTKGLWYWSVSLKRTTFDGTEYNLL 297 LLGRSSGFQV+STH PCTKGLW WS LKRT DGTEYNLL Sbjct: 87 LLGRSSGFQVASTHRPCTKGLWLWSAPLKRTALDGTEYNLL 127 Score = 26.6 bits (57), Expect(2) = 3e-13 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -1 Query: 295 LLESEGINAYDQT 257 LL+SEGI+AYDQT Sbjct: 128 LLDSEGIDAYDQT 140 >XP_012454136.1 PREDICTED: guanylate-binding protein 3-like [Gossypium raimondii] KJB69556.1 hypothetical protein B456_011G030500 [Gossypium raimondii] Length = 1067 Score = 75.5 bits (184), Expect(2) = 3e-13 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = -3 Query: 419 LLGRSSGFQVSSTH*PCTKGLWYWSVSLKRTTFDGTEYNLL 297 LLGRSSGFQV+STH PCTKGLW WS LKRT DGTEYNLL Sbjct: 89 LLGRSSGFQVASTHRPCTKGLWLWSAPLKRTALDGTEYNLL 129 Score = 26.6 bits (57), Expect(2) = 3e-13 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -1 Query: 295 LLESEGINAYDQT 257 LL+SEGI+AYDQT Sbjct: 130 LLDSEGIDAYDQT 142 >GAV87507.1 GBP domain-containing protein/GBP_C domain-containing protein [Cephalotus follicularis] Length = 1066 Score = 75.5 bits (184), Expect(2) = 3e-13 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = -3 Query: 419 LLGRSSGFQVSSTH*PCTKGLWYWSVSLKRTTFDGTEYNLL 297 LLGRSSGFQV+STH PCTKGLW WS LKRT DGTEYNLL Sbjct: 87 LLGRSSGFQVASTHRPCTKGLWLWSAPLKRTALDGTEYNLL 127 Score = 26.6 bits (57), Expect(2) = 3e-13 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -1 Query: 295 LLESEGINAYDQT 257 LL+SEGI+AYDQT Sbjct: 128 LLDSEGIDAYDQT 140 >XP_010518777.1 PREDICTED: guanylate-binding protein 1 isoform X1 [Tarenaya hassleriana] XP_010518779.1 PREDICTED: guanylate-binding protein 1 isoform X2 [Tarenaya hassleriana] Length = 1066 Score = 75.5 bits (184), Expect(2) = 3e-13 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = -3 Query: 419 LLGRSSGFQVSSTH*PCTKGLWYWSVSLKRTTFDGTEYNLL 297 LLGRSSGFQV+STH PCTKGLW WS LKRT DGTEYNLL Sbjct: 93 LLGRSSGFQVASTHKPCTKGLWLWSAPLKRTALDGTEYNLL 133 Score = 26.6 bits (57), Expect(2) = 3e-13 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -1 Query: 295 LLESEGINAYDQT 257 LL+SEGI+AYDQT Sbjct: 134 LLDSEGIDAYDQT 146 >XP_015875127.1 PREDICTED: guanylate-binding protein 3 isoform X1 [Ziziphus jujuba] Length = 1065 Score = 75.5 bits (184), Expect(2) = 3e-13 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = -3 Query: 419 LLGRSSGFQVSSTH*PCTKGLWYWSVSLKRTTFDGTEYNLL 297 LLGRSSGFQV+STH PCTKGLW WS LKRT DGTEYNLL Sbjct: 87 LLGRSSGFQVASTHRPCTKGLWLWSAPLKRTALDGTEYNLL 127 Score = 26.6 bits (57), Expect(2) = 3e-13 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -1 Query: 295 LLESEGINAYDQT 257 LL+SEGI+AYDQT Sbjct: 128 LLDSEGIDAYDQT 140 >XP_008439803.1 PREDICTED: guanylate-binding protein 2 [Cucumis melo] Length = 1063 Score = 75.5 bits (184), Expect(2) = 3e-13 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = -3 Query: 419 LLGRSSGFQVSSTH*PCTKGLWYWSVSLKRTTFDGTEYNLL 297 LLGRSSGFQV+STH PCTKGLW WS LKRT DGTEYNLL Sbjct: 84 LLGRSSGFQVASTHRPCTKGLWLWSTPLKRTALDGTEYNLL 124 Score = 26.6 bits (57), Expect(2) = 3e-13 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -1 Query: 295 LLESEGINAYDQT 257 LL+SEGI+AYDQT Sbjct: 125 LLDSEGIDAYDQT 137