BLASTX nr result
ID: Glycyrrhiza28_contig00028581
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00028581 (366 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AAX21350.1 lateral organ boundaries-like 4, partial [Lotus japon... 99 1e-23 GAU43127.1 hypothetical protein TSUD_348480 [Trifolium subterran... 90 6e-21 XP_019464145.1 PREDICTED: LOB domain-containing protein 19 [Lupi... 86 3e-18 XP_013445017.1 lateral organ boundaries (LOB) domain protein [Me... 86 4e-18 XP_004510943.1 PREDICTED: LOB domain-containing protein 19-like ... 86 4e-18 XP_007134896.1 hypothetical protein PHAVU_010G084900g [Phaseolus... 80 6e-16 KHN40140.1 LOB domain-containing protein 31 [Glycine soja] 77 5e-15 XP_017430440.1 PREDICTED: LOB domain-containing protein 19 [Vign... 76 1e-14 OIW19319.1 hypothetical protein TanjilG_07287 [Lupinus angustifo... 74 2e-14 XP_019434628.1 PREDICTED: LOB domain-containing protein 31-like,... 74 3e-14 KDO85850.1 hypothetical protein CISIN_1g034657mg [Citrus sinensis] 71 9e-14 XP_014523035.1 PREDICTED: LOB domain-containing protein 19-like ... 73 2e-13 XP_016186139.1 PREDICTED: LOB domain-containing protein 19-like ... 73 2e-13 OMP00604.1 hypothetical protein COLO4_12555 [Corchorus olitorius] 73 2e-13 OMO78581.1 hypothetical protein CCACVL1_14278 [Corchorus capsula... 72 3e-13 XP_015902800.1 PREDICTED: LOB domain-containing protein 19-like ... 72 3e-13 KYP64469.1 LOB domain-containing protein 31 [Cajanus cajan] 71 9e-13 XP_006445238.1 hypothetical protein CICLE_v10022291mg [Citrus cl... 71 1e-12 XP_006490937.1 PREDICTED: LOB domain-containing protein 19 [Citr... 71 1e-12 XP_007052037.2 PREDICTED: LOB domain-containing protein 31 [Theo... 70 2e-12 >AAX21350.1 lateral organ boundaries-like 4, partial [Lotus japonicus] Length = 167 Score = 98.6 bits (244), Expect = 1e-23 Identities = 49/58 (84%), Positives = 53/58 (91%) Frame = -2 Query: 365 NMSMHYDTLQPHSTSLELSSFFSPSDQQQLEDGELQALAREFVSRYLPGVRFQPPNSH 192 NM MH+D LQPHSTSLELS+FF+ SDQQ LEDGELQALAREFVSRYLPGVRFQP +SH Sbjct: 111 NMYMHFDPLQPHSTSLELSNFFNTSDQQ-LEDGELQALAREFVSRYLPGVRFQPSDSH 167 >GAU43127.1 hypothetical protein TSUD_348480 [Trifolium subterraneum] Length = 117 Score = 90.1 bits (222), Expect = 6e-21 Identities = 47/58 (81%), Positives = 50/58 (86%) Frame = -2 Query: 365 NMSMHYDTLQPHSTSLELSSFFSPSDQQQLEDGELQALAREFVSRYLPGVRFQPPNSH 192 NMSMH+D Q STSL+LSSFF+ SDQQ LED ELQALAREFVSRYLPGVRFQP NSH Sbjct: 61 NMSMHFDPHQQLSTSLDLSSFFNQSDQQ-LEDDELQALAREFVSRYLPGVRFQPSNSH 117 >XP_019464145.1 PREDICTED: LOB domain-containing protein 19 [Lupinus angustifolius] OIW00806.1 hypothetical protein TanjilG_18608 [Lupinus angustifolius] Length = 211 Score = 85.5 bits (210), Expect = 3e-18 Identities = 44/58 (75%), Positives = 49/58 (84%) Frame = -2 Query: 365 NMSMHYDTLQPHSTSLELSSFFSPSDQQQLEDGELQALAREFVSRYLPGVRFQPPNSH 192 N+SMH+D QP STSLELS+ +P QQ LEDGELQA+A EFVSRYLPGVRFQPPNSH Sbjct: 155 NISMHFDHPQPQSTSLELSNNVNPFCQQ-LEDGELQAVALEFVSRYLPGVRFQPPNSH 211 >XP_013445017.1 lateral organ boundaries (LOB) domain protein [Medicago truncatula] ACJ85221.1 unknown [Medicago truncatula] AFK48871.1 unknown [Medicago truncatula] KEH19042.1 lateral organ boundaries (LOB) domain protein [Medicago truncatula] Length = 216 Score = 85.5 bits (210), Expect = 4e-18 Identities = 46/58 (79%), Positives = 50/58 (86%) Frame = -2 Query: 365 NMSMHYDTLQPHSTSLELSSFFSPSDQQQLEDGELQALAREFVSRYLPGVRFQPPNSH 192 NMSMH+D QP S SL+LSSFF+ SDQQ L+D ELQALAREFVSRYLPGVRFQP NSH Sbjct: 161 NMSMHFDPHQPLS-SLDLSSFFNQSDQQ-LDDDELQALAREFVSRYLPGVRFQPSNSH 216 >XP_004510943.1 PREDICTED: LOB domain-containing protein 19-like [Cicer arietinum] Length = 216 Score = 85.5 bits (210), Expect = 4e-18 Identities = 44/58 (75%), Positives = 48/58 (82%) Frame = -2 Query: 365 NMSMHYDTLQPHSTSLELSSFFSPSDQQQLEDGELQALAREFVSRYLPGVRFQPPNSH 192 NMSMH+D Q STSL+ SSFF+ SDQQ +D ELQALAREFVSRYLPGVRFQP NSH Sbjct: 160 NMSMHFDPFQQLSTSLDSSSFFNQSDQQP-QDEELQALAREFVSRYLPGVRFQPSNSH 216 >XP_007134896.1 hypothetical protein PHAVU_010G084900g [Phaseolus vulgaris] ESW06890.1 hypothetical protein PHAVU_010G084900g [Phaseolus vulgaris] Length = 212 Score = 79.7 bits (195), Expect = 6e-16 Identities = 39/54 (72%), Positives = 42/54 (77%) Frame = -2 Query: 356 MHYDTLQPHSTSLELSSFFSPSDQQQLEDGELQALAREFVSRYLPGVRFQPPNS 195 MHYD LQPHS SLELSS QQ+ED ELQALAREFV++YLPGVRFQ NS Sbjct: 158 MHYDPLQPHSASLELSSILFNQSDQQVEDRELQALAREFVTKYLPGVRFQQSNS 211 >KHN40140.1 LOB domain-containing protein 31 [Glycine soja] Length = 214 Score = 77.4 bits (189), Expect = 5e-15 Identities = 39/54 (72%), Positives = 41/54 (75%) Frame = -2 Query: 356 MHYDTLQPHSTSLELSSFFSPSDQQQLEDGELQALAREFVSRYLPGVRFQPPNS 195 MH+D LQPHS SLELSS QQLED ELQ LAREFVS+YLPGVRFQ NS Sbjct: 160 MHFDPLQPHSASLELSSVVFNQSDQQLEDRELQVLAREFVSKYLPGVRFQQYNS 213 >XP_017430440.1 PREDICTED: LOB domain-containing protein 19 [Vigna angularis] KOM47941.1 hypothetical protein LR48_Vigan07g164500 [Vigna angularis] BAT97771.1 hypothetical protein VIGAN_09131200 [Vigna angularis var. angularis] Length = 212 Score = 76.3 bits (186), Expect = 1e-14 Identities = 38/54 (70%), Positives = 40/54 (74%) Frame = -2 Query: 356 MHYDTLQPHSTSLELSSFFSPSDQQQLEDGELQALAREFVSRYLPGVRFQPPNS 195 M YD LQPHS SLELSS QQLED ELQ LAREFV++YLPGVRFQ NS Sbjct: 158 MQYDPLQPHSASLELSSILFNQSDQQLEDRELQTLAREFVTKYLPGVRFQQSNS 211 >OIW19319.1 hypothetical protein TanjilG_07287 [Lupinus angustifolius] Length = 114 Score = 73.6 bits (179), Expect = 2e-14 Identities = 38/59 (64%), Positives = 47/59 (79%), Gaps = 1/59 (1%) Frame = -2 Query: 365 NMSMHYDTLQP-HSTSLELSSFFSPSDQQQLEDGELQALAREFVSRYLPGVRFQPPNSH 192 N+SMH+D Q STSLEL + +PS QQ +DGEL+A+A EFVSRYLPGVRF+PP+SH Sbjct: 57 NISMHFDPHQQLQSTSLELCNILNPSHQQH-KDGELEAMALEFVSRYLPGVRFKPPHSH 114 >XP_019434628.1 PREDICTED: LOB domain-containing protein 31-like, partial [Lupinus angustifolius] Length = 146 Score = 73.6 bits (179), Expect = 3e-14 Identities = 38/59 (64%), Positives = 47/59 (79%), Gaps = 1/59 (1%) Frame = -2 Query: 365 NMSMHYDTLQP-HSTSLELSSFFSPSDQQQLEDGELQALAREFVSRYLPGVRFQPPNSH 192 N+SMH+D Q STSLEL + +PS QQ +DGEL+A+A EFVSRYLPGVRF+PP+SH Sbjct: 89 NISMHFDPHQQLQSTSLELCNILNPSHQQH-KDGELEAMALEFVSRYLPGVRFKPPHSH 146 >KDO85850.1 hypothetical protein CISIN_1g034657mg [Citrus sinensis] Length = 88 Score = 70.9 bits (172), Expect = 9e-14 Identities = 34/57 (59%), Positives = 45/57 (78%) Frame = -2 Query: 365 NMSMHYDTLQPHSTSLELSSFFSPSDQQQLEDGELQALAREFVSRYLPGVRFQPPNS 195 N+SM +D LQ TS + +S F+P DQ+ ++DG+LQALAREFVS+YLPGV+ QP NS Sbjct: 32 NISMQFDPLQQQQTSTDQTSSFNPFDQE-IDDGDLQALAREFVSKYLPGVKLQPSNS 87 >XP_014523035.1 PREDICTED: LOB domain-containing protein 19-like [Vigna radiata var. radiata] Length = 212 Score = 73.2 bits (178), Expect = 2e-13 Identities = 37/54 (68%), Positives = 39/54 (72%) Frame = -2 Query: 356 MHYDTLQPHSTSLELSSFFSPSDQQQLEDGELQALAREFVSRYLPGVRFQPPNS 195 M YD LQ HS SLELSS QQLED ELQ LAREFV++YLPGVRFQ NS Sbjct: 158 MQYDPLQQHSASLELSSILFNQSDQQLEDRELQTLAREFVTKYLPGVRFQQSNS 211 >XP_016186139.1 PREDICTED: LOB domain-containing protein 19-like [Arachis ipaensis] Length = 219 Score = 73.2 bits (178), Expect = 2e-13 Identities = 40/64 (62%), Positives = 47/64 (73%), Gaps = 7/64 (10%) Frame = -2 Query: 365 NMSMHYDTLQ---PHSTSLELSSFFSPSDQQQ----LEDGELQALAREFVSRYLPGVRFQ 207 NMSM++D PHST+LE SSF + SD+ LEDG+LQ LAREFVSRYLPGVRFQ Sbjct: 154 NMSMNFDPPPQPPPHSTTLESSSFINSSDEPPPPLLLEDGDLQTLAREFVSRYLPGVRFQ 213 Query: 206 PPNS 195 P N+ Sbjct: 214 PSNN 217 >OMP00604.1 hypothetical protein COLO4_12555 [Corchorus olitorius] Length = 204 Score = 72.8 bits (177), Expect = 2e-13 Identities = 36/57 (63%), Positives = 44/57 (77%) Frame = -2 Query: 365 NMSMHYDTLQPHSTSLELSSFFSPSDQQQLEDGELQALAREFVSRYLPGVRFQPPNS 195 NMS+++D Q TS EL+SF +P DQ+ + ELQALAREFVSRYLPGVRF+P NS Sbjct: 147 NMSINFDPTQHQHTSFELTSFPNPFDQEVENEDELQALAREFVSRYLPGVRFRPSNS 203 >OMO78581.1 hypothetical protein CCACVL1_14278 [Corchorus capsularis] Length = 204 Score = 72.4 bits (176), Expect = 3e-13 Identities = 36/57 (63%), Positives = 44/57 (77%) Frame = -2 Query: 365 NMSMHYDTLQPHSTSLELSSFFSPSDQQQLEDGELQALAREFVSRYLPGVRFQPPNS 195 NMS+++D Q TS EL+SF +P DQ+ + ELQALAREFVSRYLPGVRF+P NS Sbjct: 147 NMSINFDPTQHQHTSFELTSFPNPFDQEVENEEELQALAREFVSRYLPGVRFRPSNS 203 >XP_015902800.1 PREDICTED: LOB domain-containing protein 19-like [Ziziphus jujuba] XP_015867574.1 PREDICTED: LOB domain-containing protein 19-like [Ziziphus jujuba] Length = 205 Score = 72.4 bits (176), Expect = 3e-13 Identities = 34/57 (59%), Positives = 45/57 (78%) Frame = -2 Query: 362 MSMHYDTLQPHSTSLELSSFFSPSDQQQLEDGELQALAREFVSRYLPGVRFQPPNSH 192 MSMH+D LQ + S E++S+ SP DQ+ + DG+LQALAR+FV RYLPGVRF+P S+ Sbjct: 150 MSMHFDPLQTQA-STEMTSYLSPLDQEMMNDGDLQALARDFVCRYLPGVRFRPSTSN 205 >KYP64469.1 LOB domain-containing protein 31 [Cajanus cajan] Length = 206 Score = 71.2 bits (173), Expect = 9e-13 Identities = 39/54 (72%), Positives = 43/54 (79%) Frame = -2 Query: 356 MHYDTLQPHSTSLELSSFFSPSDQQQLEDGELQALAREFVSRYLPGVRFQPPNS 195 MH D + P LELS+ F+PSDQQ LED ELQALAREFV+RYLPGVRFQP NS Sbjct: 157 MHLDPILP----LELSNVFNPSDQQ-LEDRELQALAREFVTRYLPGVRFQPSNS 205 >XP_006445238.1 hypothetical protein CICLE_v10022291mg [Citrus clementina] ESR58478.1 hypothetical protein CICLE_v10022291mg [Citrus clementina] Length = 205 Score = 70.9 bits (172), Expect = 1e-12 Identities = 34/57 (59%), Positives = 45/57 (78%) Frame = -2 Query: 365 NMSMHYDTLQPHSTSLELSSFFSPSDQQQLEDGELQALAREFVSRYLPGVRFQPPNS 195 N+SM +D LQ TS + +S F+P DQ+ ++DG+LQALAREFVS+YLPGV+ QP NS Sbjct: 149 NISMQFDPLQQQQTSTDQTSSFNPFDQE-IDDGDLQALAREFVSKYLPGVKLQPSNS 204 >XP_006490937.1 PREDICTED: LOB domain-containing protein 19 [Citrus sinensis] Length = 207 Score = 70.9 bits (172), Expect = 1e-12 Identities = 34/57 (59%), Positives = 45/57 (78%) Frame = -2 Query: 365 NMSMHYDTLQPHSTSLELSSFFSPSDQQQLEDGELQALAREFVSRYLPGVRFQPPNS 195 N+SM +D LQ TS + +S F+P DQ+ ++DG+LQALAREFVS+YLPGV+ QP NS Sbjct: 151 NISMQFDPLQQQQTSTDQTSSFNPFDQE-IDDGDLQALAREFVSKYLPGVKLQPSNS 206 >XP_007052037.2 PREDICTED: LOB domain-containing protein 31 [Theobroma cacao] Length = 203 Score = 70.1 bits (170), Expect = 2e-12 Identities = 37/57 (64%), Positives = 44/57 (77%) Frame = -2 Query: 365 NMSMHYDTLQPHSTSLELSSFFSPSDQQQLEDGELQALAREFVSRYLPGVRFQPPNS 195 NMSM +D QP S+EL+SF +P DQ+ E+ ELQALAREFVSRYLPGVRF+P S Sbjct: 147 NMSMSFDRPQPQLASVELTSFPNPFDQEP-ENEELQALAREFVSRYLPGVRFRPSTS 202